Detailed information of effector


Summary

Effector ID EFF00064 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00047 experimental (Type i1)
Strain Helicobacter hepaticus ATCC 51449
Replicon chromosome
Sequence Protein sequence (933 a.a.); Nucleotide sequence (2799 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) HH_RS09280
Coordinates (Strand) 231618..234416 (-)
NCBI ID 32265741
RefSeq NC_004917
Uniprot ID UPI00001AB1DD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.2e-22 183..458
Phage_base_V PF04717.14 2.1e-09 592..639

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-932 MSAFLSLDINSITFTITKAHIRESLQSPFHITCNGFIESFYADIFSATFASLGKTNSPSHTIQSHTQDTDFASSAPPYSFALDQPFNLQLLQDNFALLYISNPYGNTNYHSALSISLGNTSTPIKSYKGIITHIEYLGSKSNVSLDTNNTINTITDITNTSQQKTLSSLDIPTPKSINHRHFFTFTLTSPLIRLSLNKANRIYTDKTPLDILKDILTAYTPQLCKQIDFSSLSQIDNPLEIITQYEESDLDFITRLAHNNGIYFYEDNDTLYVCHHTPYTPIPLTKVPFNPNVKTHNNLNEPCIFALTHSHHIHTKQFNFFSNDANNPQINTYMYSKYIDKQSPDIATHSTSNDTSLAQEDMNNPYNYTASMQSVFIPNVSFTYQANIKSLCSNQAQHTANTQALMNAQSNIYTLCLAQRLYIESKNKSLLGNNIQDNKTQEFINEYTIIALEQTLINESILADTLPSHQQANDSNISRFKDTYSNLITLLPSNLSYMPTPKPKPNPPSLMQGIVVGEEYIKAKNIKEANASIIKQSNTLYTDNFGRVKVRLHAFMAQALLTDNDIHTTPNTNNTKHSNNTHLEDDLYTLNTHTAFLRVASPIASASSGFYHTPRVGDEVLISYLNNDIDMPIIIGSLYNPSNPALPPLPLNAHQTSLSARTLNNSSALQAENTNSHHNLIESGFNEITLSNLKEQEHIYLQAQRDYEELIKHNFLQTIHNNKESQVEGTYNERIKKIHTQTIDLAKIVSIGGEYNTNVALSKDTIVGLSHTLNVGVDNKVRIAKKSSEYVGEDKEVEIGGNLNTSIKQDESRNVGGNKREVVEGDSDISIEKKFNIQTQGEIAIHSNENIHLSSPQSLSLESDRAAVMVADNITMIADSNYLLNANNEATIQVSDTSIVAKSDSIVIKAGGVEVVIDSKGLVVKGGEVKAE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9794 - -



  Protein sequence: 933 a.a.    .

>EFF00064 NC_004917:c234416-231618 [Helicobacter hepaticus ATCC 51449]
MSAFLSLDINSITFTITKAHIRESLQSPFHITCNGFIESFYADIFSATFASLGKTNSPSHTIQSHTQDTDFASSAPPYSF
ALDQPFNLQLLQDNFALLYISNPYGNTNYHSALSISLGNTSTPIKSYKGIITHIEYLGSKSNVSLDTNNTINTITDITNT
SQQKTLSSLDIPTPKSINHRHFFTFTLTSPLIRLSLNKANRIYTDKTPLDILKDILTAYTPQLCKQIDFSSLSQIDNPLE
IITQYEESDLDFITRLAHNNGIYFYEDNDTLYVCHHTPYTPIPLTKVPFNPNVKTHNNLNEPCIFALTHSHHIHTKQFNF
FSNDANNPQINTYMYSKYIDKQSPDIATHSTSNDTSLAQEDMNNPYNYTASMQSVFIPNVSFTYQANIKSLCSNQAQHTA
NTQALMNAQSNIYTLCLAQRLYIESKNKSLLGNNIQDNKTQEFINEYTIIALEQTLINESILADTLPSHQQANDSNISRF
KDTYSNLITLLPSNLSYMPTPKPKPNPPSLMQGIVVGEEYIKAKNIKEANASIIKQSNTLYTDNFGRVKVRLHAFMAQAL
LTDNDIHTTPNTNNTKHSNNTHLEDDLYTLNTHTAFLRVASPIASASSGFYHTPRVGDEVLISYLNNDIDMPIIIGSLYN
PSNPALPPLPLNAHQTSLSARTLNNSSALQAENTNSHHNLIESGFNEITLSNLKEQEHIYLQAQRDYEELIKHNFLQTIH
NNKESQVEGTYNERIKKIHTQTIDLAKIVSIGGEYNTNVALSKDTIVGLSHTLNVGVDNKVRIAKKSSEYVGEDKEVEIG
GNLNTSIKQDESRNVGGNKREVVEGDSDISIEKKFNIQTQGEIAIHSNENIHLSSPQSLSLESDRAAVMVADNITMIADS
NYLLNANNEATIQVSDTSIVAKSDSIVIKAGGVEVVIDSKGLVVKGGEVKAE*

  Nucleotide sequence: 2799 bp    .

>EFF00064 NC_004917:c234416-231618 [Helicobacter hepaticus ATCC 51449]
ATGAGTGCTTTTCTTTCTTTGGATATTAACTCTATCACCTTTACCATCACCAAAGCCCATATTAGAGAAAGTTTGCAGTC
TCCTTTTCATATTACTTGTAATGGTTTTATAGAATCCTTTTATGCAGATATATTTTCTGCTACTTTTGCTTCTTTGGGTA
AAACAAACTCTCCCTCACACACAATCCAATCTCATACCCAAGATACCGATTTTGCATCATCTGCTCCCCCTTATTCTTTT
GCATTAGACCAACCTTTCAATCTCCAGCTATTGCAAGATAATTTTGCTCTATTATATATTTCTAATCCCTATGGCAACAC
AAACTATCATAGTGCTCTTTCTATCTCTTTAGGTAATACTTCTACCCCTATTAAATCATATAAGGGTATCATTACACATA
TAGAGTATTTAGGTTCTAAATCTAATGTTTCCTTAGATACAAATAACACAATCAACACTATTACTGACATAACCAATACT
TCTCAACAAAAGACACTCTCTTCCTTAGATATACCTACACCTAAATCTATAAACCATAGACATTTCTTTACCTTTACACT
CACTTCTCCTCTCATAAGACTTTCACTCAATAAAGCAAATAGAATCTATACAGATAAAACACCTTTAGACATACTCAAAG
ATATACTCACTGCTTATACTCCACAATTATGCAAACAAATAGATTTTTCTTCTCTTAGCCAAATTGATAATCCTTTAGAG
ATTATCACCCAATATGAAGAATCTGATTTAGATTTCATCACACGATTAGCTCATAATAATGGTATATACTTTTATGAAGA
CAATGATACCTTATATGTATGTCATCACACACCCTATACTCCTATTCCTCTCACTAAAGTCCCTTTTAATCCTAATGTAA
AAACACATAATAATCTTAATGAACCCTGTATTTTTGCTCTCACACATTCTCATCATATACACACAAAACAATTTAACTTC
TTCAGCAATGATGCAAACAATCCTCAAATCAATACTTATATGTATTCAAAATATATTGACAAACAATCCCCAGATATTGC
CACTCATTCTACATCAAATGATACTTCTCTAGCACAAGAAGATATGAATAATCCTTATAACTATACTGCCTCTATGCAAA
GTGTATTTATACCCAATGTGAGTTTTACCTATCAAGCGAATATAAAGTCTCTTTGCTCTAATCAAGCCCAACATACTGCC
AATACTCAAGCTCTTATGAACGCTCAAAGCAATATCTATACACTCTGTTTAGCTCAAAGATTATATATAGAATCTAAAAA
TAAATCTCTTTTAGGAAATAATATTCAAGATAATAAAACGCAAGAGTTTATAAATGAATATACTATCATAGCATTAGAGC
AAACCCTTATAAACGAATCTATTCTTGCAGATACTTTACCCTCTCATCAACAAGCCAATGATAGCAACATCTCTCGGTTC
AAAGATACTTATAGTAATCTTATTACTCTCTTGCCTTCAAACCTATCTTATATGCCTACACCCAAGCCCAAACCAAACCC
TCCATCTCTTATGCAAGGTATAGTTGTAGGAGAAGAGTATATAAAAGCCAAGAATATTAAAGAGGCTAATGCAAGTATCA
TCAAACAGAGCAACACGCTTTATACAGATAACTTTGGCAGGGTAAAAGTAAGGCTGCATGCCTTTATGGCACAAGCTTTA
CTCACGGATAATGATATACACACAACACCCAATACAAACAATACCAAACATTCAAACAATACTCATTTAGAAGATGATTT
ATATACTCTTAATACACACACAGCTTTTCTTAGAGTAGCCTCTCCTATTGCAAGTGCAAGTTCAGGTTTTTATCATACTC
CAAGAGTGGGAGATGAAGTATTAATAAGTTACTTAAATAATGACATAGATATGCCCATCATTATAGGCAGTCTCTACAAT
CCAAGTAATCCTGCCTTACCTCCCCTCCCTTTAAATGCTCATCAAACAAGTTTAAGTGCAAGAACTCTTAATAATAGCAG
TGCATTGCAAGCAGAGAATACAAACTCTCATCACAATCTCATAGAATCTGGATTCAATGAAATCACGCTCTCCAATCTCA
AAGAACAAGAACACATCTATCTTCAAGCACAAAGAGATTATGAAGAACTCATTAAGCATAACTTTCTCCAAACCATACAT
AACAATAAAGAATCTCAAGTAGAGGGAACTTATAATGAAAGGATTAAAAAGATTCATACTCAAACCATAGATTTAGCAAA
GATTGTAAGTATTGGAGGAGAATATAATACCAATGTAGCTTTATCTAAAGATACCATTGTAGGATTAAGTCATACTTTAA
ATGTAGGAGTAGATAACAAAGTAAGGATTGCAAAGAAGAGTAGTGAATATGTAGGAGAGGATAAGGAGGTGGAGATAGGG
GGGAATCTCAATACAAGTATCAAACAAGATGAGAGTAGGAATGTAGGGGGGAATAAGAGAGAGGTGGTGGAGGGGGACAG
CGATATAAGCATTGAGAAAAAGTTTAATATTCAAACACAAGGTGAAATTGCTATTCATTCTAATGAGAATATTCATTTGT
CATCTCCTCAATCTTTGAGTTTAGAATCTGATAGAGCTGCTGTAATGGTTGCAGACAATATAACAATGATTGCAGATTCT
AATTATCTCCTTAATGCTAATAATGAAGCAACAATTCAAGTGAGCGATACTTCTATTGTAGCCAAAAGTGATTCTATCGT
TATTAAAGCTGGTGGAGTAGAAGTAGTCATAGATTCTAAAGGATTAGTCGTTAAAGGTGGGGAGGTAAAGGCAGAGTGA