Detailed information of effector


Summary

Effector ID EFF00060 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00043 experimental (Type i1)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VP_RS06770
Coordinates (Strand) 1495971..1496489 (+)
NCBI ID 28898167
RefSeq NC_004603
Uniprot ID Q79YY3_VIBPA
KEGG ID vpa:VP1393
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.3e-30 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPLLFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGTAGNDDWRAPREA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9658 - -



  Protein sequence: 173 a.a.    .

>EFF00060 NC_004603:1495971-1496489 [Vibrio parahaemolyticus RIMD 2210633]
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPL
LFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGT
AGNDDWRAPREA*

  Nucleotide sequence: 519 bp    .

>EFF00060 NC_004603:1495971-1496489 [Vibrio parahaemolyticus RIMD 2210633]
ATGCCAACTCCAGCATATATGTCTATCAACGGTGAAACTCAAGGTCACATTACTAAAGATACATACTCTGCAGATTCAGT
AGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGTGCTAACTGTTCCACGTGATC
CACAAAGTGGTCAACCTACTGGTCAACGTGTACACCGTCCACTTGTTGTGACTAAAGTTCAAGACCGTTCTTCTCCACTA
CTATTTAACGCACTAGTGTCTGGTGAAAAACTTCCTGAGTGTTTGATTCGTTTCTACCGTACTTCAGTTCAAGGCAAGCA
AGAGCACTACTACTCAATCAAGCTGATTGATGCGCTATTGGTAGATATCCAAACTCGTATGAACCACTGTCAAGATGCAG
CAACAGCTGATCGCGTTACAGAAGAAGTTCTTAAGTTTACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACA
GCTGGTAACGACGACTGGCGTGCTCCACGCGAAGCATAA