Detailed information of effector


Summary

Effector ID EFF00045 experimental
Effector type Tae
Cognate immunity protein IMU00073 experimental
Related T6SS (Type) T6SS00035 experimental (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Sequence Protein sequence (124 a.a.); Nucleotide sequence (372 bp)
Description Tae3; peptidoglycan amidase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PFL_5498 (Tae3)
Coordinates (Strand) 6278373..6278744 (+)
NCBI ID 70732799
RefSeq NC_004129
Uniprot ID UPI000054E04D
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-123 MWNKEAAISHLNAHAHAGSTGRCAAYTRQAIEAGGGGVILHRKHSAKDFGSSLTSAGFIEQPAGQTPAAGDVVIIQPIPGHPHGHMAMFNGTLWVSDFKQLHGFYPGHSYRVQKPAYKIYRHP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8556 - -



  Protein sequence: 124 a.a.    .

>EFF00045 NC_004129:6278373-6278744 [Pseudomonas protegens Pf-5]
MWNKEAAISHLNAHAHAGSTGRCAAYTRQAIEAGGGGVILHRKHSAKDFGSSLTSAGFIEQPAGQTPAAGDVVIIQPIPG
HPHGHMAMFNGTLWVSDFKQLHGFYPGHSYRVQKPAYKIYRHP*

  Nucleotide sequence: 372 bp    .

>EFF00045 NC_004129:6278373-6278744 [Pseudomonas protegens Pf-5]
ATGTGGAATAAAGAAGCCGCTATCAGTCACTTGAACGCTCACGCTCACGCCGGTAGTACGGGGCGCTGTGCGGCCTATAC
TCGCCAGGCGATCGAAGCCGGTGGCGGTGGGGTGATTCTGCACAGGAAGCACTCGGCCAAGGACTTCGGCTCATCATTGA
CTTCTGCAGGTTTCATCGAACAGCCGGCCGGCCAGACGCCCGCAGCGGGCGATGTGGTGATCATCCAGCCCATTCCAGGG
CACCCCCACGGTCACATGGCGATGTTCAACGGCACACTCTGGGTGTCAGACTTCAAGCAACTGCACGGTTTCTACCCGGG
GCATTCCTACCGGGTGCAGAAACCTGCCTACAAAATCTATCGCCATCCGTAA