Detailed information of effector


Summary

Effector ID EFF00024 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ATU_RS20350
Coordinates (Strand) 1479996..1480472 (+)
NCBI ID 15890638
RefSeq NC_003063
Uniprot ID A9CGG8_AGRFC
KEGG ID atu:Atu4345
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 8.8e-33 4..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9890 - -



  Protein sequence: 159 a.a.    .

>EFF00024 NC_003063:1479996-1480472 [Agrobacterium fabrum str. C58]
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGK
LATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA*

  Nucleotide sequence: 477 bp    .

>EFF00024 NC_003063:1479996-1480472 [Agrobacterium fabrum str. C58]
ATGCCAATTTATCTGCAGATTGACGGTATCCAGGGCGACGCCACCCATGAAGAACATCGCAAGTGGATGGATATTGAAGC
CATTCACTGGAACGTGGCCCGCAACATGAACACGTCGGCTGGTTCTGCTGCAAACCGCGAAGCGTCCGAACCGACCATTT
CGGAAGTCATTCTGACAAAGGTTAGCGACTCGTCTTCCACAAAGCTTTTCCAGGAGGCCTGTGCTGGCCGCACTGGCAAG
CTTGCAACGATTCATCTGGTGACGACCGGCAATCCGGGCAACACCTATATCGAATACCTGCTGACGAACACCCTTATCGC
CAGCTACTCGGTGGATTCCAGCGGGGATCGTCCGGTGGAGACCATCAAGCTCAACTTCACGAAAATGGAAGTGAAGTACA
CGCCGTTCGACGACAACAACTCGCCGCAGTCTCCGATGATCGCTTCCTACGATCTGGCGACGACCAAGGCTGCTTGA