Detailed information of effector


Summary

Effector ID EFF00020 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00006 insolico (Type i1)
Strain Escherichia coli O157:H7 str. EDL933
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description Hcp protein
Reference
[1] Wan B, Zhang Q, Ni J, et al. Type VI secretion system contributes to Enterohemorrhagic Escherichia coli virulence by secreting catalase against host reactive oxygen species (ROS). PLoS Pathog. 2017 Mar 13;13(3):e1006246. doi: 10.1371/journal.ppat.1006246. eCollection 2017 Mar. PMID: 28288207
[2] de Pace F, Nakazato G, Pacheco A, et al. The type VI secretion system plays a role in type 1 fimbria expression and pathogenesis of an avian pathogenic Escherichia coli strain. Infect Immun. 2010 Dec;78(12):4990-8. doi: 10.1128/IAI.00531-10. Epub 2010 Sep 20. PMID: 20855516
[3] de Pace F, Boldrin de Paiva J, Nakazato G, et al. Characterization of IcmF of the type VI secretion system in an avian pathogenic Escherichia coli (APEC) strain. Microbiology (Reading). 2011 Oct;157(Pt 10):2954-2962. doi: 10.1099/mic.0.050005-0. Epub 2011 Jul 21. PMID: 21778203
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Z0266 (Hcp2)
Coordinates (Strand) 264134..264652 (+)
NCBI ID 447065702
RefSeq NC_002655
Uniprot ID A0A0E0Y4V8_ECO1C, L3QI00_ECOLX, U9YRG6_ECOLX, V0YIY8_ECOLX, A7ZHX3_ECO24, A0A0E1SSY5_ECOLX, A0A0H3PHB8_ECO5C, D6I5D3_ECOLX, E0J653_ECOLW, A0A170UYG5_KLEOX, B7LHE1_ECO55, A0A1X3JLW6_ECOLX, A0A1X3L786_ECOLX, F4VA08_ECOLX, A0A1X3IBM1_ECOLX, F4TA69_ECOLX, A0A1X3LM59_ECOLX, A0A1X3J5C3_ECOLX, E9XQ91_ECOLX, E6BQG9_ECOLX, E1IYR3_ECOLX, E1JBS7_ECOLX, D8E9U8_ECOLX, D7XRD3_ECOLX, E9TA15_ECOLX, Q7DC35_ECO57, I2UQJ1_ECOLX, I2WRX5_ECOLX, F0JUI5_ESCFE
KEGG ID ecw:EcE24377A_0243, esl:O3K_20405, elw:ECW_m0233, eck:EC55989_0235, ecs:ECs0234
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5e-32 8..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9242 - -



  Protein sequence: 173 a.a.    .

>EFF00020 NC_002655:264134-264652 [Escherichia coli O157:H7 str. EDL933]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPL
MYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGT
SGADDWRAPLEA*

  Nucleotide sequence: 519 bp    .

>EFF00020 NC_002655:264134-264652 [Escherichia coli O157:H7 str. EDL933]
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCGCTGATTCTGT
CGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAACGTTACTGTCCCGACCGATC
CTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTTACCGTGGCGCTGAACAAAGCGGTTCCGCTG
ATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCACTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACA
GGAGCATTATTTCACTACCCGCCTGACTGATTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGG
CGAAACGCGAGTTCACCCAGTTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACC
TCCGGTGCCGACGACTGGCGCGCACCGCTGGAAGCATAA