Detailed information of effector


Summary

Effector ID EFF00015 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (727 a.a.); Nucleotide sequence (2181 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA2685
Coordinates (Strand) 3035752..3037932 (-)
NCBI ID 15597881
RefSeq NC_002516
Uniprot ID VGR1C_PSEAE
KEGG ID pae:PA2685
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 1e-102 66..366
Phage_base_V PF04717.14 1.7e-14 423..490
Gp5_C PF06715.14 6.1e-05 566..589

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-726 VAIGQPFATALGCTIIWRAAGALFGPPAAGDYQGRFPMLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSRRYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIEAIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCIDAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAERNQDIEVENDESHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVDRNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVSVGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5103 - -



  Protein sequence: 727 a.a.    .

>EFF00015 NC_002516:c3037932-3035752 [Pseudomonas aeruginosa PAO1]
VAIGQPFATALGCTIIWRAAGALFGPPAAGDYQGRFPMLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELV
SSNPALPLDALLGKPMSLALELPGGSRRYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQ
VFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPP
SLGHRERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIEAIQ
TQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCIDAGQAFRPLPSTP
VPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDP
DRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAERNQDIEVENDESHWVGHDR
TKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVDRNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMM
NTVVGLNQSTQVMKKKTLSVGDSYEVSVGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSP
NVDINC*

  Nucleotide sequence: 2181 bp    .

>EFF00015 NC_002516:c3037932-3035752 [Pseudomonas aeruginosa PAO1]
GTGGCTATTGGCCAGCCTTTCGCGACGGCACTGGGTTGTACGATCATCTGGCGCGCTGCTGGCGCGTTGTTCGGGCCGCC
CGCCGCAGGTGACTATCAAGGAAGATTCCCCATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGG
GACCCGAGGTCCTGCAACTGCAACGGCTGGAGGGTCGCGAAGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTC
TCGAGCAATCCCGCCTTGCCTCTGGATGCCCTGTTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCG
GCGGTATTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGGTCACCCTGC
GGCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGTCCCGGACATCATCAAGCAG
GTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCCTACCGCGAGTGGGAATACTGTGTGCAATA
CCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGCAGGAAGGCATCTACTACTGGTTCCGCCACGAAAAGAAGC
GCCACATCCTGGTGCTCTCCGATGCCTACGGCGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCG
AGCCTCGGCCATCGCGAGCGCGACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAA
CGACTACGACTTCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACC
CGCTCTACGACTACCCTGGCGAGTATGTGCAGAGTCAGGACGGCGAACACTATGCACGGACCCGCATCGAGGCGATCCAG
ACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGTTCCACCTGAGCAACTACCC
GCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGTAGTCCAGGAACTCTACGAGACCGGTAATG
GCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATCGACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCG
GTGCCGGTGGTGCGCGGCCCGCAGACCGCGGTGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTATGGCCG
GGTCAAGGTGCATTTCCACTGGGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCT
GGGCCGGGAAGAACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCG
GACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCTACCCAGAG
CGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAGAAGGGCGCCG
AGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACGACGAGAGCCACTGGGTCGGCCACGACCGG
ACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCACGATCGCACCGAGACCGTGGACAACAACGAGACCATCAC
CGTGCATGCCAACCGCAGCAAGACGGTCGACCGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCA
TGGCCTCGTTGCAGAACGTCGGCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATG
AACACCGTGGTCGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAG
CGTGGGCGGCAGCGACGATGGCTCTAAGATCACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCATCGAGCTGA
CCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGAGATCGAGATCCTCTCGCCC
AATGTCGATATCAACTGTTGA