Detailed information of effector


Summary

Effector ID EFF00012 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0263 (hcp2)
Coordinates (Strand) 297043..297561 (-)
NCBI ID 15595460
RefSeq NC_002516
Uniprot ID MAJE_PSEAE
KEGG ID pae:PA0263, pae:PA1512, pae:PA5267
PDB ID 3HE1

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 6.5e-39 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9168 - -



  Protein sequence: 173 a.a.    .

>EFF00012 NC_002516:c297561-297043 [Pseudomonas aeruginosa PAO1]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPL
LLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGT
SGSDDWRSPVAG*

  Nucleotide sequence: 519 bp    .

>EFF00012 NC_002516:c297561-297043 [Pseudomonas aeruginosa PAO1]
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCGAGGACTCGGT
CGGCAACACCTATCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGAAGTGATCATCCCGCGCGACC
CGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATCACCAAGGTCTTCGACAAGGCCTCGCCGCTG
CTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGGTCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCA
GGAGCACTACTACACCACCGTCCTGGAAGACGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGG
GCAACGCCCACTTCACCCACCTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACC
TCCGGCTCCGACGACTGGCGCTCGCCGGTGGCAGGGTGA