Detailed information of effector


Summary

Effector ID EFF00011 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (742 a.a.); Nucleotide sequence (2226 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0095
Coordinates (Strand) 115299..117524 (+)
NCBI ID 15595293
RefSeq NC_002516
Uniprot ID VGR1B_PSEAE
KEGG ID pae:PA0095
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 4.2e-106 29..329
Phage_base_V PF04717.14 7e-15 386..453
Gp5_C PF06715.14 2.9e-05 529..552
Gp5_C PF06715.14 6.5e-05 633..656

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-741 MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9959 - -



  Protein sequence: 742 a.a.    .

>EFF00011 NC_002516:115299-117524 [Pseudomonas aeruginosa PAO1]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSRRHFHGIVAAC
SQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSR
LMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREVQSGSLSLNDYDFQRPGAR
LEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLV
VGAEYRVVQELYETGGGGVGAQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRH
DQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADRSESVG
ANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGS
GAINVKADKNVVVKGRKILQN*

  Nucleotide sequence: 2226 bp    .

>EFF00011 NC_002516:115299-117524 [Pseudomonas aeruginosa PAO1]
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGCAGCGAATGGA
GGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCCCGACCTGCCACTCGACGGGC
TGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGGCGGCATTTCCACGGCATCGTCGCCGCTTGC
AGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGGTCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTC
CGACTGCCGCATCTTCCAGAACCAGAAGGTCCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCG
AGGACGCCCTGAGCCGCTCCTACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGG
CTGATGGAGCAGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGCGACCATTTCT
ACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCGCTGAGCCTCAACGACTACGACTTCCAGCGTCCCGGCGCGCGC
CTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCCGCTGTACGACTACCCCGGCGAATACGTGCA
GAGCCAGGACGGCGAGCAGTACGCGCGGACCCGTATCGAAGCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCC
GCGCCCGCGGCCTGGGTTCGGGCCACCTGTTCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTG
GTCGGCGCCGAGTACCGGGTGGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCT
GGACTGCATCGATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTGGGATCGCCAC
GACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAGAACTGGGGTTCGATGCAGAT
CCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGGACCGGCCGATCATCACCGGGCGGGTCTACA
ACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCCACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGC
ACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCA
GGACATCGAGGTCGAGAACGACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGC
ACGTGAAGCACGATCGCACCGAGACCGTGGACAACAACGAGACCATAACCATCGGCGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCGGCGTCGACCG
CACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGTCGGCAACGACGAGACCATCA
GCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGCATCGGCGCCGACCGCAGCGAGTCGGTGGGC
GCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCAGCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCG
CGATACCTCGGTGGGCAAGGACGATAGCCTGGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGG
TCACCGGTGCCGCCAGCATCCGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCC
GGGGCGATCAACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA