Detailed information of effector


Summary

Effector ID EFF00010 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (644 a.a.); Nucleotide sequence (1932 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0091
Coordinates (Strand) 110976..112907 (+)
NCBI ID 15595289
RefSeq NC_002516
Uniprot ID VGR1A_PSEAE
KEGG ID pae:PA0091
PDB ID 6H3N, 4MTK, 4UHV, 6H3L

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.6e-104 26..326
Phage_base_V PF04717.14 5.8e-15 383..450

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-643 MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRNLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPPAKG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9964 - -



  Protein sequence: 644 a.a.    .

>EFF00010 NC_002516:110976-112907 [Pseudomonas aeruginosa PAO1]
MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQV
AGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRNLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLME
QEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGARLEV
RSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGA
EYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQS
NENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPA
NFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTY
LIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPP
AKG*

  Nucleotide sequence: 1932 bp    .

>EFF00010 NC_002516:110976-112907 [Pseudomonas aeruginosa PAO1]
ATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGCAGCGCATGGAGGGACGCGA
GGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCCCAACCTGCCGCTGGAGCAGTTGCTCGGCA
AGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGGCGCTTCTTTCACGGCATCGTCGCGCGCTGTAGCCAGGTG
GCCGGGCACGGCCAGTTCGCCGGCTACCAGGCCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCG
CATCTTCCAGAACCAGAGCGTGCCGGAGATCATCAAGCAGGTGTTCCGCAACCTCGGCTTTTCCGATTTCGAGGATGCCC
TCACGCGCCCCTACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAA
CAGGAAGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGGCGCGCATCG
CAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGCGACCACTTCTTCGACTGGC
AGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACTTCCAGCGCCCCGGCGCGCGCCTGGAGGTG
CGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCCGCTGTACGACTATCCCGGCGAATACGTGCAGAGCCAGGA
CGGCGAGCAGTACGCGCGCAACCGCATCGAGGCGATCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGCG
GGATCGGCGCCGGGCACCTGTTCCGCCTGAGCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCC
GAATACCGGGTGGTCCAGGAACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCAT
CGACGCCAGCCAGTCGTTCCGTCTCCTGCCGCAGACTCCGGTACCGGTGGTGCGGGGTCCGCAGACCGCGGTGGTGGTCG
GACCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTGGGATCGCCACGACCAGTCG
AACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAGAACTGGGGTTCGATGCAGATCCCGCGGAT
CGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGGACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGC
AGACGGTGCCCTACGAGCTGCCGGCGAACGCCACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCC
AACTTCAACGAGATCCGCATGGAGGACAAGAAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCT
GGTCGAGAACGATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCA
ACAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGTTGGTGGGCGGGGCGAAGAGCGACAGCGTCACCGGCACCTAC
CTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACGCCGACGGCACCATCAATAT
CTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACACCGGCGGCCGCCTCGACCTCAATTCCGGCG
GCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGCACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCG
GCGAAGGGCTGA