Detailed information of effector


Summary

Effector ID EFF00009 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (163 a.a.); Nucleotide sequence (489 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0085
Coordinates (Strand) 103350..103838 (+)
NCBI ID 15595283
RefSeq NC_002516
Uniprot ID HCP1_PSEAE
KEGG ID pae:PA0085
PDB ID 1Y12, 6AP1

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.8e-43 6..136

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-162 MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9577 - -



  Protein sequence: 163 a.a.    .

>EFF00009 NC_002516:103350-103838 [Pseudomonas aeruginosa PAO1]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYP
QAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNV
QA*

  Nucleotide sequence: 489 bp    .

>EFF00009 NC_002516:103350-103838 [Pseudomonas aeruginosa PAO1]
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGGAAATCGACGT
GCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGGCGCCGGCAAGGTCAACGTGC
AGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATGATGGCCTGCTCCAGCGGCAAGCACTATCCG
CAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACCAGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGT
GTCCTCGGTGAGCACCGGCGGCAGCGGTGGCGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGG
TCGACTACCAGCCGCAGAAGGCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTG
CAGGCCTGA