Detailed information of effector


Summary

Effector ID EFF00006 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description Hcp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VC_RS06845
Coordinates (Strand) 1509632..1510150 (+)
NCBI ID 15641426
RefSeq NC_002505
Uniprot ID H9L4Q3_VIBCH
KEGG ID vch:VC1415, vch:VCA0017
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.3e-35 6..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7783 - -



  Protein sequence: 173 a.a.    .

>EFF00006 NC_002505:1509632-1510150 [Vibrio cholerae O1 biovar El Tor str. N16961]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPL
LYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGT
SGSDDWRKPIEA*

  Nucleotide sequence: 519 bp    .

>EFF00006 NC_002505:1509632-1510150 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTGCTGACTCTAT
CGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGTTGTGACTGTACCGACTGACC
CACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTCACTGTGGCGCTGAACAAAGCGGTTCCTCTG
CTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAAACCGTTGAGCTGAAGTGGTACCGTACCTCTATCGAAGGTAAACA
AGAGAACTTCTTCACCACTAAGCTGGAAAACGCGTCTATCGTCGACATCCACTGTGAAATGCCACACTGCCAAGACCCAG
CAAAATCTGACTTTACTCAGAATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACC
TCAGGCTCTGATGACTGGCGTAAGCCAATCGAAGCGTAA