Detailed information of effector


Summary

Effector ID EFF00004 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (228 a.a.); Nucleotide sequence (684 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0118
Coordinates (Strand) 130352..131035 (+)
NCBI ID 15600889
RefSeq NC_002506
Uniprot ID Q9KN47_VIBCH
KEGG ID vch:VCA0118
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VasI PF11319.10 7.8e-55 46..227

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 VPEIGDQNP
Transmembrane helix 10-32 MRITVLVVSLILGCAGSAHVLAA
Inside 33-227 SQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.5884 pos: 22-23. ILG-CA. VPEIGDQNPMRITVLVVSLILG



  Protein sequence: 228 a.a.    .

>EFF00004 NC_002506:130352-131035 [Vibrio cholerae O1 biovar El Tor str. N16961]
VPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYPA
EWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEVADARIQVSIRH
ETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFDTRGVNEALDALRERCGW*

  Nucleotide sequence: 684 bp    .

>EFF00004 NC_002506:130352-131035 [Vibrio cholerae O1 biovar El Tor str. N16961]
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCGCGGGCTCTGC
GCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCGCGAAATTCCTGCGCGTTTAG
AGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTGGCTATCGCACCGTCCAATCCTTATCCCGCA
GAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGTCCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCG
GGGCAGCAGCGCTTGGATTGCTTTGCCTGCGCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTT
GCATTAATAACCTGAGCCGCATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACAC
GAGACACAGTTCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGATACTCGAGGTG
TCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA