Detailed information of effector


Summary

Effector ID EFF00002 experimental
Effector type -
Cognate immunity protein -
Related T6SS (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (695 a.a.); Nucleotide sequence (2085 bp)
Description VgrG
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCA0018
Coordinates (Strand) 20427..22511 (+)
NCBI ID 15600789
RefSeq NC_002506
Uniprot ID VGRG2_VIBCH
KEGG ID vch:VCA0018
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.4e-75 42..334
Phage_base_V PF04717.14 9.7e-14 392..458

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-694 MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYAFALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGGTMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYNNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSEIGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGSGSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9830 - -



  Protein sequence: 695 a.a.    .

>EFF00002 NC_002506:20427-22511 [Vibrio cholerae O1 biovar El Tor str. N16961]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLYRNSQLVQRVH
GIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYAFALKRDCVQREFCVQYRESD
IDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGGTMDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMN
RDWVVVSINHQGEQPQALQEEGGSGATTYNNQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHF
PWDRYSNGNEQSSCWVRVSQGWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGSGSGYGGKMAE
LPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN*

  Nucleotide sequence: 2085 bp    .

>EFF00002 NC_002506:20427-22511 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTCACGGGCAGGA
GTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTATCAAATGCAACTGGCGAGTCGGGTATCCA
ATCTGACTGCCGACCAGATGGTCGATAAGCGTGCTGAGCTCAAGCTTTACCGCAACTCACAATTGGTGCAGCGTGTGCAC
GGCATTGTACGTGCCTTTAGCCAAGGCGATATCGGCCATCACCACACCTTCTACCAACTCACTTTAGTGCCTGCCTTAGA
GCGCTTATCCCTGCGCCACAATAGCCGCATTTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGA
TGGGCATCCACGATTACGCTTTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGAT
ATCGACTTTCTGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGCACGATGGATA
CACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCAAAGATTACAGCTTCAAAAAG
CCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCAGCAAACGCGCTACCAACATTTTGATGCGCC
GGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGCCAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCG
CAACAGGGCAGAGCAACGAGCCGCTGCTGCGTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAAC
CGCGATTGGGTGGTGGTCTCTATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAAC
GACCTACAACAACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAAAATCCATTTT
CCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAAGGTTGGGCGGGCAGTCAGTA
TGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCTTAAATGGCGACCCAGACCAACCGATTATCA
CTGGCCGCACCTATCATGCGACCAATACGCCGCCATACACTTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAG
ACGCACCAAGGGGAAGGGTTTAACGAGCTCAGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAA
AGACTTCGATGGTTTGATTGAAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGT
TCACTCAGATTAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTAAAGCGGGTAA
CAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAAAGTCGATGCTGGCGGTGTGC
ACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGCGGCTCAGGCTATGGCGGTAAAATGGCCGAG
TTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGATTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTC
GCCTTTACTTAAGGCGCGACAAATTGAAGCACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAA
ATTAA