Detailed information of component protein
Summary
| Component ID | T6CP259650 |
| Component protein type | TssA |
| T6SS ID (Type) | T6SS01262  (Type i1) |
| Strain | Vibrio parahaemolyticus strain 12-297/B |
| Replicon | chromosome |
| Sequence | Protein sequence (432 a.a.); Nucleotide sequence (1296 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 33530..34825 (-) |
| NCBI ID | WP_025533653.1 |
| RefSeq | NZ_MYFG01000475 |
| Uniprot ID | - |
| KEGG ID | - |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-230 | MFFSDFTRRPIDESNPSGTNPNGLDDFDEIKRQINGLNKVTGRVSWKTVQTLSKEILRTKGKDFRCSCYFTVAAINNDGLKGLVEGLNSVLDLCVVYWYSAYPEYTKANARISAIEWMVEYTEKRMKKHRVLPEELPLIEAAHQLCLRIEEELRLHYGIKAPSFGRIRRPLNQWIEEIKEEKTKQEKTSQTKPASNPPSAGIRVEIAPPNRPVQKKVEQPKVEEEAKSSR |
| Transmembrane helix | 231-250 | FIVYTMIGLLIIAFTSHFIY |
| Inside | 251-431 | KQHQYTILKERIGSASLTELVTIVNSLSVENKNYQDDLRSVTVERLHTLMSGWTLDPVKVSQVNTIEQLTNDLTKLYPDSSSAQQLRDNFLGQRSYFEDEFEAIYKRFAYARTVFANIAKQSADKDAKKAYEYSNSLFPLLGRIEYAEKNSQRKEIERSLLLLNAYLYKINQLQAAEKDNK |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9452 | - | - |
Protein sequence: 432 a.a.
Nucleotide sequence: 1296 bp