Detailed information of component protein


Summary

Component ID T6CP259642
Component protein type TssC
T6SS ID (Type) T6SS17510 experimental (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome II
Sequence Protein sequence (727 a.a.); Nucleotide sequence (2181 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BGLU_RS21550
Coordinate (Strand) 898308..900488 (-)
NCBI ID WP_012733561.1
RefSeq NC_012721
Uniprot ID A0A2J9HJ08_BURGL, C5AMW6_BURGB
KEGG ID bgl:bglu_2g07480
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 4.9e-128 279..604
VipB_2 PF18945.2 1e-44 614..724
T6SS_VipA PF05591.14 3.3e-30 11..157

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-726 MSESVQKKLLRIRPPRVRITYDVETGGAIEKTELPFIVGILADLKGEREDAEHYPSLKERSMIEIDRDNFDDVMKKIQPRATFTQLKQDDAALKALLVQDGDNALIFPNMEAFEPLKVIKALPSLNDIYVNRGKIRDLQARAETSDPVSKVLDAMIQGAVLGQAAVAAQPAVPDQPEVPAVPAVPADGDKPAVEAVPGKPAVKGTPAVAAKDAVPALQDSAVETALAALADLRKKDVAVPDDLNVTKFAEQFKLFYVASNDDVAKITEARKRGAIAVIDALIAEIDKQLSDAVSSIMHCDSFKTMEATWRGLNYLVMNTETSTTLKLRVFDAQKEELRSDMVKAVEFDQSALFKMIYEAEYGTYGGKPYSLLVGDYAIAKTPQDIEFVTKMAEVAAAAHAPFLAQASTDLFSLANFGELDKPRDLKKIFEGEEYEAWREFRDLEDARYVTLALPRALLRLPYGMPTKRSTTPCDGINFDERIGASGKDDTLYGKDASEPLSYAKPAPDHLLWGNPAYLLAQRITNAFAHYSWTAAIRGEEGGGLVENLPLYTYTSDNGSTELLCPTEISITDRREKELNDLGFISLCHCKGTGKAAFFGGQTTNQPKKYFSDAANANARISALLPYMLAASRFAHYIKVIMRQKIGSFQTRGNVEDYLNSWISNYVLLDDNASQDAKAAYPLREAKVQVSEVPGEPGSYRAVVFLKPHFQLEELTTSIRLVANLPK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9981 - -



  Protein sequence: 727 a.a.    

>T6CP259642 NC_012721:c900488-898308 [Burkholderia glumae BGR1] [TssC]
MSESVQKKLLRIRPPRVRITYDVETGGAIEKTELPFIVGILADLKGEREDAEHYPSLKERSMIEIDRDNFDDVMKKIQPR
ATFTQLKQDDAALKALLVQDGDNALIFPNMEAFEPLKVIKALPSLNDIYVNRGKIRDLQARAETSDPVSKVLDAMIQGAV
LGQAAVAAQPAVPDQPEVPAVPAVPADGDKPAVEAVPGKPAVKGTPAVAAKDAVPALQDSAVETALAALADLRKKDVAVP
DDLNVTKFAEQFKLFYVASNDDVAKITEARKRGAIAVIDALIAEIDKQLSDAVSSIMHCDSFKTMEATWRGLNYLVMNTE
TSTTLKLRVFDAQKEELRSDMVKAVEFDQSALFKMIYEAEYGTYGGKPYSLLVGDYAIAKTPQDIEFVTKMAEVAAAAHA
PFLAQASTDLFSLANFGELDKPRDLKKIFEGEEYEAWREFRDLEDARYVTLALPRALLRLPYGMPTKRSTTPCDGINFDE
RIGASGKDDTLYGKDASEPLSYAKPAPDHLLWGNPAYLLAQRITNAFAHYSWTAAIRGEEGGGLVENLPLYTYTSDNGST
ELLCPTEISITDRREKELNDLGFISLCHCKGTGKAAFFGGQTTNQPKKYFSDAANANARISALLPYMLAASRFAHYIKVI
MRQKIGSFQTRGNVEDYLNSWISNYVLLDDNASQDAKAAYPLREAKVQVSEVPGEPGSYRAVVFLKPHFQLEELTTSIRL
VANLPK*

  Nucleotide sequence: 2181 bp    

>T6CP259642 NC_012721:c900488-898308 [Burkholderia glumae BGR1] [TssC]
ATGAGTGAAAGCGTGCAGAAGAAGCTCCTGCGTATTCGCCCTCCCCGGGTGAGGATCACGTACGACGTGGAGACGGGTGG
CGCCATCGAGAAGACGGAGCTGCCGTTCATCGTCGGCATCCTGGCCGACCTGAAGGGCGAGCGCGAAGATGCGGAACACT
ATCCGTCGCTGAAGGAGCGGTCGATGATCGAGATCGATCGCGACAACTTCGACGACGTGATGAAGAAGATCCAGCCGCGC
GCCACCTTCACGCAGCTGAAGCAGGACGACGCGGCGCTGAAGGCTCTGCTCGTGCAGGACGGCGACAACGCGCTGATCTT
CCCGAACATGGAAGCGTTCGAACCGCTGAAGGTGATCAAGGCGCTGCCGTCGCTGAACGACATCTACGTCAACCGCGGCA
AGATCCGCGACCTGCAGGCGCGCGCGGAAACGAGCGACCCCGTCAGCAAGGTGCTCGATGCGATGATCCAAGGCGCGGTG
CTCGGCCAGGCCGCCGTGGCGGCCCAGCCCGCGGTGCCCGATCAGCCCGAGGTGCCAGCCGTGCCGGCCGTGCCGGCCGA
CGGCGACAAGCCGGCCGTCGAGGCGGTGCCGGGCAAGCCCGCCGTCAAGGGCACGCCGGCGGTGGCGGCCAAGGATGCCG
TGCCGGCCCTGCAGGACTCGGCCGTCGAGACCGCGCTCGCGGCGCTCGCCGATCTGCGCAAGAAGGACGTCGCGGTGCCC
GACGATCTGAACGTCACGAAGTTCGCGGAGCAGTTCAAGCTCTTCTACGTCGCCAGCAACGACGACGTGGCGAAGATCAC
CGAGGCGCGCAAGCGCGGCGCGATTGCCGTGATCGACGCGCTGATCGCCGAGATCGACAAGCAGCTCAGCGACGCGGTGT
CGAGCATCATGCACTGCGACAGCTTCAAGACGATGGAGGCGACCTGGCGCGGCCTCAACTACCTGGTGATGAACACCGAG
ACCAGCACGACGCTGAAGCTGCGCGTGTTCGACGCCCAGAAGGAAGAGCTGCGCAGCGACATGGTGAAGGCGGTCGAGTT
CGACCAGAGCGCCCTCTTCAAGATGATCTACGAGGCCGAGTACGGCACCTACGGCGGCAAGCCGTACAGCCTGCTGGTGG
GCGACTACGCGATCGCCAAGACCCCGCAGGACATCGAGTTCGTCACCAAGATGGCCGAGGTGGCCGCCGCCGCCCACGCG
CCGTTCCTCGCGCAGGCATCGACCGATCTGTTCAGCCTCGCGAACTTCGGCGAGCTCGACAAGCCGCGCGATCTGAAGAA
GATCTTCGAGGGCGAGGAGTACGAGGCATGGCGCGAATTCCGCGACCTCGAGGACGCGCGCTACGTCACGCTCGCGCTGC
CGCGCGCGCTGCTGCGCCTGCCCTACGGCATGCCCACCAAGCGCAGCACCACGCCGTGCGACGGCATCAACTTCGACGAG
CGCATCGGCGCCTCGGGCAAGGACGACACGCTCTACGGCAAGGACGCCAGCGAGCCGCTCAGCTACGCGAAGCCGGCCCC
GGACCATCTGCTGTGGGGCAACCCGGCCTACCTGCTCGCGCAGCGCATCACCAACGCGTTCGCGCACTACAGCTGGACGG
CGGCGATCCGCGGCGAGGAAGGCGGCGGCCTGGTGGAGAACCTGCCGCTCTATACCTACACCTCCGACAACGGCAGCACC
GAGCTGCTCTGCCCGACCGAGATCTCGATCACCGATCGCCGCGAGAAGGAGCTCAACGACCTCGGCTTCATCTCGCTCTG
CCATTGCAAGGGCACCGGCAAGGCGGCGTTCTTCGGCGGCCAGACCACCAACCAGCCGAAGAAGTACTTCTCGGACGCGG
CCAACGCCAACGCCCGGATCTCCGCGCTGCTGCCGTACATGCTCGCCGCGTCGCGCTTCGCGCATTACATCAAGGTCATC
ATGCGTCAGAAGATCGGCTCGTTCCAGACCCGCGGCAACGTCGAGGACTACCTCAACTCGTGGATCTCGAACTACGTGCT
GCTCGACGACAACGCCTCGCAGGACGCCAAGGCCGCCTACCCGCTGCGTGAAGCGAAGGTGCAGGTGAGCGAGGTGCCGG
GCGAGCCGGGCTCGTACCGCGCCGTGGTGTTCCTCAAGCCGCACTTCCAGCTCGAGGAGCTGACGACTTCGATCCGGCTC
GTGGCCAACCTGCCGAAATAA