Detailed information of component protein


Summary

Component ID T6CP259638
Component protein type TssG
T6SS ID (Type) T6SS17510 experimental (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome II
Sequence Protein sequence (380 a.a.); Nucleotide sequence (1140 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BGLU_RS21525
Coordinate (Strand) 894260..895399 (-)
NCBI ID WP_080569382.1
RefSeq NC_012721
Uniprot ID UPI0009B6554F
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 5.8e-51 39..353

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-379 IRGLQRVPVDAPHAVRYRQAPADRAAPAVSRRPVGRVPRQRVHARGGAAARAVRAAPGLRGAPRPAARHCRRGRRPLARRRGRARRAARFEITTANLCVASVSGPMPEPFTEWARELAALRATAMADFFDIFNQRANVLRYELKQRLTPGLDDTPPERTEAAGCLAALVGLGSPQLSSRVPLPQRAWLGIAGLLANRRRQGATLVEVLRVALGARVELTENVGAWHDLDERDRCALGRRNHRLGQTSVVGRRVWDQQARVRLEIGVLDYAALCRLLPPAPNPAPAAVPGLAAPAAPGYAMLSGLVKLLVDRLADVEIVLQVDDASIPDAGTPLPQPARGTDGSSMRLGQSAWLAGAPAHRHATRPVRFLITTRDSGSLA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6058 - -



  Protein sequence: 380 a.a.    

>T6CP259638 NC_012721:c895399-894260 [Burkholderia glumae BGR1] [TssG]
IRGLQRVPVDAPHAVRYRQAPADRAAPAVSRRPVGRVPRQRVHARGGAAARAVRAAPGLRGAPRPAARHCRRGRRPLARR
RGRARRAARFEITTANLCVASVSGPMPEPFTEWARELAALRATAMADFFDIFNQRANVLRYELKQRLTPGLDDTPPERTE
AAGCLAALVGLGSPQLSSRVPLPQRAWLGIAGLLANRRRQGATLVEVLRVALGARVELTENVGAWHDLDERDRCALGRRN
HRLGQTSVVGRRVWDQQARVRLEIGVLDYAALCRLLPPAPNPAPAAVPGLAAPAAPGYAMLSGLVKLLVDRLADVEIVLQ
VDDASIPDAGTPLPQPARGTDGSSMRLGQSAWLAGAPAHRHATRPVRFLITTRDSGSLA*

  Nucleotide sequence: 1140 bp    

>T6CP259638 NC_012721:c895399-894260 [Burkholderia glumae BGR1] [TssG]
ATACGAGGACTTCAACGTGTTCCAGTTGATGCGCCTCATGCTGTCCGATACCGACAAGCGCCTGCCGATCGGGCGGCGCC
TGCGGTTTCGCGCCGACCTGTCGGCCGCGTTCCCCGCCAGCGAGTTCACGCGCGTGGCGGCGCCGCCGCCCGTGCCGTCC
GTGCCGCCCCCGGCCTCCGGGGCGCACCTCGACCCGCCGCCCGGCACTGCCGCCGCGGGCGGCGCCCCCTTGCCCGCCGC
CGAGGCCGTGCCCGCCGCGCCGCGCGCTTCGAGATCACCACCGCGAACCTGTGCGTGGCCAGCGTGAGCGGGCCGATGCC
CGAGCCGTTCACCGAGTGGGCGCGCGAACTCGCGGCGCTGCGCGCGACCGCGATGGCCGACTTCTTCGACATCTTCAACC
AGCGCGCCAACGTGCTGCGCTACGAGCTGAAGCAGCGCCTCACGCCGGGCCTCGACGACACGCCGCCGGAGCGCACCGAG
GCGGCCGGCTGCCTGGCGGCGCTGGTCGGCCTGGGCAGCCCGCAGCTGAGCAGCCGGGTGCCGCTGCCGCAGCGCGCCTG
GCTCGGCATCGCGGGCCTGCTGGCGAACCGGCGCCGGCAGGGCGCGACGCTGGTGGAGGTGCTGCGCGTGGCGCTCGGCG
CGCGCGTCGAGCTGACCGAGAACGTCGGCGCGTGGCACGACCTCGACGAGCGCGACCGCTGCGCGCTCGGCCGCCGCAAT
CACCGGCTCGGCCAGACCAGCGTGGTGGGGCGCCGCGTGTGGGACCAGCAGGCGCGCGTGCGCCTCGAGATCGGCGTGCT
CGACTACGCGGCGCTGTGCCGCCTGCTGCCGCCCGCGCCGAACCCGGCGCCGGCCGCCGTGCCCGGCCTGGCCGCGCCGG
CCGCGCCCGGTTACGCGATGCTCAGCGGCCTCGTGAAGCTGCTGGTCGATCGCCTCGCCGACGTCGAGATCGTGCTGCAG
GTGGACGACGCGAGCATCCCCGACGCCGGCACGCCGCTGCCCCAGCCCGCGCGCGGCACCGACGGCAGCTCGATGCGGCT
CGGCCAGAGCGCCTGGCTCGCCGGCGCGCCCGCGCATCGCCACGCCACGCGGCCGGTGCGCTTTCTCATCACCACCCGCG
ATTCCGGGAGCCTCGCATGA