Detailed information of component protein


Summary

Component ID T6CP259635
Component protein type TssL
T6SS ID (Type) T6SS17510 experimental (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome II
Sequence Protein sequence (260 a.a.); Nucleotide sequence (780 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BGLU_RS21485
Coordinate (Strand) 884185..884964 (-)
NCBI ID WP_012733549.1
RefSeq NC_012721
Uniprot ID A0A2J9HJ17_BURGL, C5AMV4_BURGB
KEGG ID bgl:bglu_2g07360
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 2.5e-21 62..246

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-229 MRDAPHWPQPHPGTPDLVARFADFYQELAAIKAAQTGGWLAVYLAGDGAPQPVTGSEFAKRVSARLLALLQRQERRHADEADTAAGRAERQARYLMAALADEVLIFELDWPGRDAWLPVLLEQAMFGSSNAGSRFFSMAEQLIQDTARTALQAELASVFLLAMELGFKGRYRARQAQPQLERIRGQLYQVVFAASGKLDDEQPAFAEAYAYPLTGRRDERLAPLSPWRN
Transmembrane helix 230-249 LGLYGLIGYLVLSVIAWFVL
Outside 250-259 MHPFEHYLNG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9653 - -



  Protein sequence: 260 a.a.    

>T6CP259635 NC_012721:c884964-884185 [Burkholderia glumae BGR1] [TssL]
MRDAPHWPQPHPGTPDLVARFADFYQELAAIKAAQTGGWLAVYLAGDGAPQPVTGSEFAKRVSARLLALLQRQERRHADE
ADTAAGRAERQARYLMAALADEVLIFELDWPGRDAWLPVLLEQAMFGSSNAGSRFFSMAEQLIQDTARTALQAELASVFL
LAMELGFKGRYRARQAQPQLERIRGQLYQVVFAASGKLDDEQPAFAEAYAYPLTGRRDERLAPLSPWRNLGLYGLIGYLV
LSVIAWFVLMHPFEHYLNG*

  Nucleotide sequence: 780 bp    

>T6CP259635 NC_012721:c884964-884185 [Burkholderia glumae BGR1] [TssL]
ATGCGTGACGCCCCGCACTGGCCGCAGCCGCATCCGGGCACGCCCGATCTGGTGGCGCGCTTCGCCGACTTCTACCAGGA
GCTGGCCGCCATCAAGGCCGCCCAGACGGGCGGCTGGCTGGCCGTCTATCTGGCCGGCGACGGCGCGCCCCAGCCCGTCA
CCGGCAGCGAGTTCGCCAAGCGCGTGAGCGCGCGGCTGCTCGCCCTGCTGCAACGCCAGGAGCGCCGCCACGCCGACGAG
GCCGACACCGCGGCCGGGCGCGCGGAGCGGCAGGCGCGCTACCTGATGGCGGCGCTCGCCGACGAGGTGCTGATCTTCGA
GCTCGACTGGCCCGGGCGCGACGCCTGGCTGCCGGTGCTGCTGGAGCAGGCGATGTTCGGATCGAGCAACGCGGGCTCGC
GGTTCTTCTCGATGGCCGAGCAGCTGATCCAGGACACCGCGCGCACCGCGCTGCAAGCCGAGCTCGCCTCGGTGTTCCTG
CTCGCGATGGAGCTGGGCTTCAAGGGCCGCTACCGCGCGCGCCAGGCGCAGCCGCAGCTGGAACGGATCCGCGGCCAGCT
CTACCAGGTCGTGTTCGCCGCCAGCGGCAAGCTCGACGACGAGCAGCCGGCATTCGCCGAGGCCTACGCGTATCCGCTCA
CGGGCCGCCGCGACGAGCGCCTCGCGCCGCTGTCGCCGTGGCGCAATCTCGGGCTCTACGGGTTGATCGGCTACCTCGTG
CTGTCGGTGATCGCGTGGTTCGTGCTGATGCACCCGTTCGAACATTATCTGAATGGCTAG