Detailed information of component protein


Summary

Component ID T6CP259634
Component protein type TssM
T6SS ID (Type) T6SS17510 experimental (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome II
Sequence Protein sequence (1340 a.a.); Nucleotide sequence (4020 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BGLU_RS21480
Coordinate (Strand) 880140..884159 (-)
NCBI ID WP_012733548.1
RefSeq NC_012721
Uniprot ID A0A2J9HJ04_BURGL, C5AMV3_BURGB
KEGG ID bgl:bglu_2g07350
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 2.2e-51 172..413

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 VDAILKSTAWLKAQ
Transmembrane helix 15-37 TGWAPAAGTLKLVLGVLAALLAL
Inside 38-409 AVLAKLAGKLWARLGPLLKAPAVPPLCGCEPAAETRAKGWIERASLALDYLRTGREWRYATPWLLVLGQAGAGKTSLLESVGPQHTQPLGERQQSLALEGASWHAIDQSLVLDPLGKWPEAAASAMLDSGTADGADARRWLKFLDQLDALRPERALDGIVLVVCATTFLQRDPARLMAAAQNARQQLRTIEDRLEFALPVYVVVTACDHVEGFGAFWRSQAPQRHTEMVGWSAPSQTFDTPPTQWGAQIFAAIGAQLRALQVETAAHCERIAADDADPMFLYPLRFAQLQGPFEQWLSVVFQVSAWETTFFLRGVYFTGLVAEPGEPLEARDGPRRDVAFVRDLMLEKVLAEKHLARPTRAGVWSRNLLIRR
Transmembrane helix 410-432 VQWACVIGFSLLLLAFAVRVWMI
Outside 433-1339 DAQIGRVIQALERMQQLQAPAPGAGCIAQAPVYQLIEQVAQIDADASSWLLPASLFDSRLSHQSARRVIDTALRKVILPGLACQLSQRAYALGNEANRGISAGLGYTQALDQLQGFVQQADQYERNAARFQRLLGKTPYARERVPLPGFFDLVEYAYRTPVPPYLRAHAGLLPVTLGDLTERDFSGEIATPPQLRQSVGNHIVALAAQAGSLLQAELQSGLPLLEQLQARQQPILAHVRQFTHWLNWIRTAWLGSSAAANPILTVQNQLLASLQPLVADFGYPSYIQAQVSAQFDAAHQYPLAMQTLNALTLPGYGALFVNVNGQITLNPAMQGELTGLDALGSLGYMSIDPLASFSCTGKLANWSQGLLKDAAQYPADYRKFLAQPMLKGGQPDALYRQLARYQLELAMNNQLAQAQAAAGYAASGTDTSTEAQQSADSGNFAAVAPLVLNVEQQFRALGMDGSATQLTQCAHQYANSQLGRISLLADQSQLYQPAYLPASPAPDAYFFDLGSTPVVTDMLARQVSRVQVLVGYAQPFLTYLGQAGPSASNASANTANAAYWNNTASELRRYTQGKDPNSQPAVLDNLFLKLLPALQNDNCGEQLAAYSSPALGNDLFSNYRGQLMQGVQMHCKGERYAQAQNAFQPVASRFTRDLAGRYPFGTLDADDASLDAVKGFFTDYEGRRAALQKQVAGINDPYWKSVRQFLAQLDQVDAFLQGNVVPGTAPGDPAADPLLSLNVNFRALKPGANGSNQIIEMNLVSGAKGASFPNGGSTLDWQFGQPLVLDLSWAGLSPWRPSLAVGAPDLQVDGNTASFAAAGNWALLRMMERHRPSADPATDPRDATRSLLQFDVPVLDSSRAGSPATDTAHVFLGIRLSNVNAKTPTPLKLPAVFPISVPPLTPRP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8806 - -



  Protein sequence: 1340 a.a.    

>T6CP259634 NC_012721:c884159-880140 [Burkholderia glumae BGR1] [TssM]
VDAILKSTAWLKAQTGWAPAAGTLKLVLGVLAALLALAVLAKLAGKLWARLGPLLKAPAVPPLCGCEPAAETRAKGWIER
ASLALDYLRTGREWRYATPWLLVLGQAGAGKTSLLESVGPQHTQPLGERQQSLALEGASWHAIDQSLVLDPLGKWPEAAA
SAMLDSGTADGADARRWLKFLDQLDALRPERALDGIVLVVCATTFLQRDPARLMAAAQNARQQLRTIEDRLEFALPVYVV
VTACDHVEGFGAFWRSQAPQRHTEMVGWSAPSQTFDTPPTQWGAQIFAAIGAQLRALQVETAAHCERIAADDADPMFLYP
LRFAQLQGPFEQWLSVVFQVSAWETTFFLRGVYFTGLVAEPGEPLEARDGPRRDVAFVRDLMLEKVLAEKHLARPTRAGV
WSRNLLIRRVQWACVIGFSLLLLAFAVRVWMIDAQIGRVIQALERMQQLQAPAPGAGCIAQAPVYQLIEQVAQIDADASS
WLLPASLFDSRLSHQSARRVIDTALRKVILPGLACQLSQRAYALGNEANRGISAGLGYTQALDQLQGFVQQADQYERNAA
RFQRLLGKTPYARERVPLPGFFDLVEYAYRTPVPPYLRAHAGLLPVTLGDLTERDFSGEIATPPQLRQSVGNHIVALAAQ
AGSLLQAELQSGLPLLEQLQARQQPILAHVRQFTHWLNWIRTAWLGSSAAANPILTVQNQLLASLQPLVADFGYPSYIQA
QVSAQFDAAHQYPLAMQTLNALTLPGYGALFVNVNGQITLNPAMQGELTGLDALGSLGYMSIDPLASFSCTGKLANWSQG
LLKDAAQYPADYRKFLAQPMLKGGQPDALYRQLARYQLELAMNNQLAQAQAAAGYAASGTDTSTEAQQSADSGNFAAVAP
LVLNVEQQFRALGMDGSATQLTQCAHQYANSQLGRISLLADQSQLYQPAYLPASPAPDAYFFDLGSTPVVTDMLARQVSR
VQVLVGYAQPFLTYLGQAGPSASNASANTANAAYWNNTASELRRYTQGKDPNSQPAVLDNLFLKLLPALQNDNCGEQLAA
YSSPALGNDLFSNYRGQLMQGVQMHCKGERYAQAQNAFQPVASRFTRDLAGRYPFGTLDADDASLDAVKGFFTDYEGRRA
ALQKQVAGINDPYWKSVRQFLAQLDQVDAFLQGNVVPGTAPGDPAADPLLSLNVNFRALKPGANGSNQIIEMNLVSGAKG
ASFPNGGSTLDWQFGQPLVLDLSWAGLSPWRPSLAVGAPDLQVDGNTASFAAAGNWALLRMMERHRPSADPATDPRDATR
SLLQFDVPVLDSSRAGSPATDTAHVFLGIRLSNVNAKTPTPLKLPAVFPISVPPLTPRP*

  Nucleotide sequence: 4020 bp    

>T6CP259634 NC_012721:c884159-880140 [Burkholderia glumae BGR1] [TssM]
GTGGACGCAATACTGAAATCGACCGCCTGGCTGAAGGCGCAGACCGGCTGGGCACCCGCTGCCGGCACGCTGAAGCTGGT
GCTGGGCGTGCTGGCCGCCCTGCTCGCGCTGGCCGTGCTGGCGAAGCTGGCCGGCAAGCTGTGGGCCAGGCTCGGGCCGC
TCCTGAAGGCGCCGGCCGTGCCGCCGCTGTGCGGCTGCGAGCCCGCCGCCGAGACCCGCGCGAAGGGCTGGATCGAACGC
GCCTCGCTTGCCCTCGACTATTTGCGCACCGGGCGCGAGTGGCGCTACGCGACGCCCTGGCTGCTGGTGCTCGGCCAGGC
CGGGGCCGGCAAGACCAGCCTGCTCGAATCGGTCGGCCCGCAGCACACGCAGCCGCTCGGCGAGCGGCAGCAGAGCCTCG
CGCTGGAAGGCGCGAGCTGGCACGCGATCGACCAGAGCCTGGTGCTCGATCCGCTCGGCAAGTGGCCCGAGGCGGCCGCC
AGCGCGATGCTCGACAGCGGCACGGCGGACGGCGCCGATGCGCGCCGCTGGCTGAAGTTCCTCGACCAGCTCGACGCGCT
GCGCCCCGAGCGCGCGCTCGACGGCATCGTGCTGGTGGTGTGCGCCACCACCTTCCTGCAGCGCGACCCGGCCCGCCTGA
TGGCCGCCGCGCAGAACGCGCGCCAGCAGCTGCGCACCATCGAGGACCGGCTCGAATTCGCACTGCCCGTCTATGTCGTG
GTCACCGCCTGCGATCACGTCGAGGGCTTCGGCGCGTTCTGGCGCTCGCAGGCGCCGCAGCGGCACACCGAGATGGTGGG
CTGGTCGGCGCCGAGCCAGACCTTCGACACGCCGCCCACCCAGTGGGGCGCGCAGATCTTCGCGGCGATCGGCGCCCAGC
TGCGCGCGCTGCAGGTGGAGACCGCCGCGCACTGCGAGCGGATCGCCGCCGACGACGCCGACCCGATGTTCCTCTACCCG
CTGCGCTTCGCGCAGTTGCAGGGGCCGTTCGAGCAGTGGCTGTCGGTGGTGTTCCAGGTATCGGCCTGGGAGACCACCTT
CTTCCTGCGCGGCGTCTATTTCACCGGCCTCGTCGCCGAGCCCGGCGAGCCGCTCGAAGCGCGCGACGGCCCGCGCCGCG
ACGTGGCGTTCGTGCGCGACCTGATGCTCGAGAAGGTGCTCGCGGAGAAGCATCTGGCGCGCCCGACGCGCGCCGGCGTG
TGGTCGCGCAACCTGCTGATCCGCCGCGTGCAGTGGGCCTGCGTGATCGGCTTCTCGCTGCTGCTGCTGGCGTTCGCCGT
GCGGGTGTGGATGATCGACGCGCAGATCGGCCGGGTGATCCAGGCGCTCGAGCGCATGCAGCAGCTGCAGGCACCCGCGC
CCGGCGCCGGCTGCATCGCGCAGGCGCCCGTCTATCAGCTGATCGAGCAGGTCGCGCAGATCGACGCCGACGCCAGCAGC
TGGCTGCTGCCGGCGTCGCTGTTCGATTCGCGGCTGAGCCACCAGAGCGCGCGGCGCGTGATCGACACCGCGTTGCGCAA
GGTGATCCTGCCGGGGCTCGCGTGCCAGCTGTCGCAACGCGCCTACGCGCTCGGCAACGAGGCCAATCGCGGCATCTCCG
CCGGGCTCGGCTACACCCAGGCGCTCGACCAGCTCCAAGGCTTCGTGCAGCAGGCCGACCAGTACGAGCGCAACGCGGCG
CGCTTCCAGCGCCTGCTGGGCAAGACCCCCTACGCGCGCGAGCGCGTGCCGTTGCCCGGCTTCTTCGATCTGGTCGAATA
CGCCTACCGCACGCCGGTGCCGCCGTATCTGCGCGCGCATGCCGGCCTGCTGCCCGTCACCCTCGGCGATCTCACCGAGC
GCGATTTCAGCGGCGAGATCGCCACCCCGCCGCAGCTCAGGCAGAGCGTCGGCAATCACATCGTCGCGCTGGCCGCGCAG
GCGGGCAGCCTGCTGCAGGCCGAACTGCAATCGGGCCTGCCGCTGCTCGAACAGCTGCAGGCCAGGCAGCAGCCGATCCT
CGCGCACGTCAGGCAGTTCACGCACTGGCTGAACTGGATCCGCACCGCGTGGCTCGGCTCCAGCGCCGCCGCCAACCCGA
TCCTGACGGTGCAGAACCAGCTGCTCGCGAGCCTGCAGCCGCTGGTCGCCGACTTCGGCTATCCGTCCTACATCCAGGCC
CAGGTCAGCGCGCAATTCGACGCCGCGCATCAGTATCCGCTCGCGATGCAGACGCTGAACGCGCTGACGCTGCCCGGCTA
CGGCGCGCTGTTCGTCAACGTCAACGGCCAGATCACGCTGAACCCGGCGATGCAGGGCGAGCTGACCGGCCTCGACGCGC
TCGGCAGCCTCGGCTACATGTCGATCGATCCGCTCGCCAGCTTCAGCTGCACGGGCAAGCTCGCCAACTGGAGCCAGGGC
CTGCTCAAGGACGCCGCCCAGTACCCGGCCGACTACCGGAAGTTCCTGGCCCAGCCGATGCTCAAGGGCGGCCAGCCCGA
CGCGCTCTATCGCCAGCTCGCGCGCTACCAGCTCGAACTGGCGATGAACAACCAGCTCGCGCAGGCGCAGGCCGCGGCCG
GCTACGCCGCGAGCGGCACCGACACCAGCACCGAGGCGCAGCAGAGCGCCGACAGCGGCAATTTCGCGGCCGTCGCGCCG
CTGGTGCTGAACGTGGAGCAGCAGTTCCGCGCGCTGGGCATGGACGGCAGCGCCACGCAGCTCACGCAGTGCGCGCACCA
GTACGCCAACAGCCAGCTCGGCCGCATCTCGCTGCTGGCCGACCAGAGCCAGCTGTATCAGCCGGCCTACCTGCCCGCCT
CGCCGGCCCCGGACGCCTACTTCTTCGATCTCGGCAGCACGCCGGTGGTGACCGACATGCTGGCGCGCCAGGTCAGCCGC
GTGCAGGTGCTGGTCGGCTACGCCCAGCCGTTCCTGACCTATCTCGGGCAGGCCGGGCCGTCGGCCTCGAACGCGAGCGC
CAACACCGCCAACGCGGCCTACTGGAACAACACCGCCAGCGAACTCAGGCGCTACACGCAGGGCAAGGACCCGAACTCGC
AGCCGGCCGTGCTCGACAACCTGTTCCTGAAGCTGCTGCCGGCGCTGCAGAACGACAACTGCGGCGAGCAGCTGGCCGCG
TACTCGTCGCCCGCGCTCGGCAACGATCTGTTCTCGAACTACCGCGGCCAGCTCATGCAGGGCGTGCAGATGCACTGCAA
GGGCGAGCGTTACGCGCAGGCGCAGAACGCGTTCCAGCCGGTGGCGAGCCGCTTCACGCGCGACCTGGCGGGCCGCTATC
CGTTCGGCACGCTCGACGCCGACGACGCCAGCCTCGACGCCGTGAAGGGCTTCTTCACCGACTACGAGGGCCGGCGCGCC
GCACTGCAGAAGCAGGTGGCGGGCATCAACGATCCGTACTGGAAGAGCGTGCGGCAGTTCCTCGCGCAGCTCGATCAGGT
GGACGCGTTCCTGCAGGGCAACGTGGTGCCGGGCACGGCGCCGGGCGACCCCGCCGCCGATCCGCTGCTGAGCCTGAACG
TCAACTTCCGCGCCCTCAAGCCCGGCGCGAACGGCAGCAACCAGATCATCGAGATGAACCTGGTGTCGGGCGCCAAGGGC
GCCTCGTTCCCGAACGGCGGCAGCACCCTGGACTGGCAGTTCGGGCAGCCGCTGGTGCTCGACCTGTCGTGGGCCGGCCT
CTCGCCGTGGCGGCCGTCGCTGGCCGTCGGCGCGCCCGATCTGCAGGTGGACGGCAACACCGCGTCGTTCGCGGCCGCCG
GCAACTGGGCGCTGCTGCGTATGATGGAGCGCCATCGGCCCAGCGCGGATCCGGCCACCGATCCGCGCGACGCCACGCGC
TCGCTGCTGCAGTTCGACGTGCCGGTGCTCGATTCGAGCCGCGCCGGCAGCCCGGCCACCGATACCGCACACGTATTCCT
CGGTATCCGGCTGTCGAACGTCAACGCGAAAACCCCGACGCCGCTGAAATTGCCGGCGGTATTCCCGATCTCGGTTCCTC
CCTTGACGCCACGACCATGA