Detailed information of component protein


Summary

Component ID T6CP259536
Component protein type TssD
T6SS ID (Type) T6SS17503 experimental (Type i1)
Strain Aeromonas hydrophila strain NF1
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BE47_RS0109360
Coordinate (Strand) 79971..80489 (-)
NCBI ID WP_010634822.1
RefSeq NZ_JDWB01000021
Uniprot ID A0A2H9U664_9GAMM, A0A1E4X6L5_9GAMM, A0A2R4TWW1_AERHY, A0A261E6Q7_9GAMM, Q0PZH6_AERHY, A0A3A9IH47_9GAMM, A0A448KZH2_9GAMM
KEGG ID ahi:VU14_13095, ahh:RY45_19895, ael:NCTC12917_03267, aaj:BOQ57_08965, ahh:RY45_09925, ahi:VU14_15950
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 7.9e-32 7..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGKTQGNITAGAFTSDSVGNIFVQGHEDEMLVQEFQHVVTVPTDPQSGQPAGQRVHKPFKFTVALNKAVPLMYNSLASGEMLPKVTLKWYRTSVEGKQEHFFSTVLTDATIVDIDCQMPHCQDPAKSDFTQLIQVSLAYRKIDWEHTVAGTSGADDWRAPIEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9760 - -



  Protein sequence: 173 a.a.    

>T6CP259536 NZ_JDWB01000021:c80489-79971 [Aeromonas hydrophila] [TssD]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIFVQGHEDEMLVQEFQHVVTVPTDPQSGQPAGQRVHKPFKFTVALNKAVPL
MYNSLASGEMLPKVTLKWYRTSVEGKQEHFFSTVLTDATIVDIDCQMPHCQDPAKSDFTQLIQVSLAYRKIDWEHTVAGT
SGADDWRAPIEA*

  Nucleotide sequence: 519 bp    

>T6CP259536 NZ_JDWB01000021:c80489-79971 [Aeromonas hydrophila] [TssD]
ATGCCAACTCCATGTTATATCAGCATCGAAGGTAAAACCCAGGGCAACATCACCGCCGGTGCCTTCACTTCCGATTCCGT
CGGCAACATCTTCGTGCAGGGCCACGAAGACGAGATGCTGGTACAAGAGTTCCAGCACGTCGTGACCGTACCGACTGACC
CGCAATCTGGTCAGCCTGCTGGTCAGCGTGTCCACAAGCCGTTCAAGTTCACCGTTGCGCTGAACAAAGCCGTGCCGCTG
ATGTACAACTCCCTGGCCTCCGGCGAAATGCTGCCGAAAGTGACCCTGAAGTGGTACCGCACCTCTGTCGAGGGCAAGCA
GGAACACTTTTTCTCTACCGTGCTGACCGATGCCACCATCGTTGACATCGACTGCCAGATGCCGCACTGCCAGGATCCGG
CGAAGTCTGACTTCACCCAGCTGATCCAGGTCTCTCTGGCCTACCGCAAAATCGATTGGGAACACACCGTTGCCGGCACT
TCCGGTGCGGACGACTGGCGTGCGCCGATCGAGGCGTAA