Detailed information of component protein


Summary

Component ID T6CP259534
Component protein type TssC
T6SS ID (Type) T6SS17503 experimental (Type i1)
Strain Aeromonas hydrophila strain NF1
Replicon chromosome
Sequence Protein sequence (493 a.a.); Nucleotide sequence (1479 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BE47_RS0109340
Coordinate (Strand) 72386..73864 (-)
NCBI ID WP_005299978.1
RefSeq NZ_JDWB01000021
Uniprot ID A0A3Q8DPU1_9GAMM, K1JBN3_9GAMM
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 4.4e-128 66..365
VipB_2 PF18945.2 4.6e-45 378..489

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-492 MSLVEEQVQAGASAASSSLLDEIMAQARITPVDEGYSVAKQGVAALIANILDSGTTSEPVNKALVDSMIVELDKKLSKQMDVILHAKELQEMESSWRSLKLLVDRTDFRENIKIQVLHATKEELLEDFEFSPEITQSGLYKHVYSTGYGQFGGQPVGAVIGDYAFTHSSPDIKLMQYVSAVGAMAHAPFISSVAPAFFGVDSFTDLPSIKDLKSVFEGPAYTKWRSLRESEDARYLGLTAPRFLARLPYDPTENPIKGFNYQEDISSDHDHYLWGNTAYLMGTSLTDSFAKYRWCPNIIGPQSGGAIHDLPVHVYEAMGQLQAKIPTEVLITDRREYELSEEGFITLTMRKDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLERELNGWIKQYVADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVAMAVRPHFKYMGASFELSLVGRLDKE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9572 - -



  Protein sequence: 493 a.a.    

>T6CP259534 NZ_JDWB01000021:c73864-72386 [Aeromonas hydrophila] [TssC]
MSLVEEQVQAGASAASSSLLDEIMAQARITPVDEGYSVAKQGVAALIANILDSGTTSEPVNKALVDSMIVELDKKLSKQM
DVILHAKELQEMESSWRSLKLLVDRTDFRENIKIQVLHATKEELLEDFEFSPEITQSGLYKHVYSTGYGQFGGQPVGAVI
GDYAFTHSSPDIKLMQYVSAVGAMAHAPFISSVAPAFFGVDSFTDLPSIKDLKSVFEGPAYTKWRSLRESEDARYLGLTA
PRFLARLPYDPTENPIKGFNYQEDISSDHDHYLWGNTAYLMGTSLTDSFAKYRWCPNIIGPQSGGAIHDLPVHVYEAMGQ
LQAKIPTEVLITDRREYELSEEGFITLTMRKDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAH
YIKVLQREQIGSWKERQDLERELNGWIKQYVADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVAMAVRPHFKYMGAS
FELSLVGRLDKE*

  Nucleotide sequence: 1479 bp    

>T6CP259534 NZ_JDWB01000021:c73864-72386 [Aeromonas hydrophila] [TssC]
ATGTCTTTGGTCGAAGAACAGGTTCAAGCGGGGGCGAGTGCCGCCTCCTCGTCCTTGCTGGACGAAATCATGGCGCAGGC
TCGTATTACCCCGGTGGATGAAGGTTACAGCGTTGCCAAGCAGGGGGTTGCAGCCCTGATCGCCAACATTCTGGACAGCG
GTACCACCAGCGAGCCAGTCAACAAGGCGCTGGTGGACAGCATGATTGTCGAGCTCGACAAGAAGCTCAGCAAGCAGATG
GACGTCATCCTGCACGCCAAAGAGCTGCAGGAGATGGAGTCCTCCTGGCGTTCCCTGAAGCTCTTGGTGGATCGCACCGA
TTTTCGCGAGAACATCAAGATCCAGGTGCTGCATGCCACCAAGGAAGAGCTGCTGGAAGATTTTGAGTTCTCACCCGAAA
TCACCCAGTCCGGTCTCTACAAGCATGTCTACTCGACTGGCTACGGTCAGTTCGGTGGCCAGCCCGTCGGCGCTGTGATC
GGTGATTACGCCTTTACCCACAGCTCACCGGACATCAAGCTGATGCAATACGTCAGTGCGGTGGGTGCCATGGCCCATGC
GCCGTTCATTTCTTCCGTCGCACCAGCCTTCTTCGGCGTCGACAGCTTTACCGATCTGCCTTCCATCAAGGATCTGAAAT
CGGTATTCGAAGGGCCGGCCTACACCAAGTGGCGTTCCCTGCGTGAATCGGAAGATGCCCGTTATCTGGGACTGACCGCA
CCGCGCTTCCTGGCGCGTCTGCCCTACGACCCGACCGAAAACCCCATCAAGGGTTTCAACTATCAGGAAGATATCAGCTC
GGATCACGACCACTATCTGTGGGGCAACACCGCCTACCTGATGGGTACTTCCCTGACCGACAGTTTCGCCAAGTATCGTT
GGTGCCCGAACATCATAGGCCCGCAGAGCGGTGGTGCCATCCACGACCTGCCGGTGCACGTCTACGAGGCCATGGGTCAG
CTGCAGGCGAAGATCCCGACCGAGGTGCTGATCACCGACCGTCGCGAATACGAGCTGTCGGAAGAGGGCTTCATCACCCT
GACCATGCGCAAGGACAGCGACAACGCCGCCTTCTTCTCCGCCAACTCGGTGCAAAAACCCAAGGTGTTCCCGAACACCA
AGGAAGGCAAAGAAGCGGAAACCAACTACAAGCTGGGTACCCAGCTGCCCTACATGTTCATCATCAACCGCCTGGCGCAC
TACATCAAAGTGCTGCAGCGCGAGCAGATCGGTTCCTGGAAGGAGCGTCAGGATCTGGAACGCGAGCTGAATGGCTGGAT
CAAGCAGTACGTTGCCGATCAGGAGAACCCGCCGGCAGACGTACGTAGCCGTCGTCCGCTGCGCGCCGCGCAGATCAAGG
TGCTGGATGTGGAAGGGGAGCCGGGCTGGTACCAGGTTGCCATGGCCGTGCGCCCGCACTTCAAGTACATGGGGGCGAGC
TTCGAGCTCTCTCTGGTAGGTCGACTGGACAAGGAATAA