Detailed information of component protein


Summary

Component ID T6CP210274
Component protein type TssD
T6SS ID (Type) T6SS14097 experimental (Type i3)
Strain Enterobacter cloacae strain DSM 30054
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) HWQ16_RS19740
Coordinate (Strand) 4048386..4048868 (+)
NCBI ID WP_008502640.1
RefSeq NZ_CP056776
Uniprot ID W7PMH0_9ENTR, A0A1H8NZH1_9ENTR, A0A0J6QBZ6_9ENTR, A0A1S2AGP3_9ENTR, A0A1M5IMD7_9GAMM, A0A1Z3MVW2_9ENTR, A0A808ICU2_9ENTR, A0A4P6Y289_9ENTR, A0A0F1B2S9_9ENTR, A0A2S4SQA5_9ENTR, A0A855M4C9_9ENTR, A0A5E1AC95_9ENTR, A0A2U3F0D5_9ENTR, A0A8B2SC39_9ENTR, A0A8B3JP31_9ENTR, A0A3A3ZFR4_9ENTR, A0A1J5WMM3_9ENTR, A0A126PNA0_ENTCL, A0A8B2UQV1_9ENTR, A0A331GJG2_KLEPN, A0A0E3AAP6_ENTAS, A0A0H3CHH7_ENTCC, A0A2J7S2P4_9ENTR
KEGG ID lni:CWR52_21975, ecls:LI67_012800, enc:ECL_01541, ern:BFV67_12850, eclg:EC036_26020
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 7.7e-37 6..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAILKHCASGKHLTKVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTTSGGKGAESSAGWNIKENKEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9458 - -



  Protein sequence: 161 a.a.    

>T6CP210274 NZ_CP056776:4048386-4048868 [Enterobacter cloacae] [TssD]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAILKHCASGKHLT
KVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTTSGGKGAESSAGWNIKENKEA
*

  Nucleotide sequence: 483 bp    

>T6CP210274 NZ_CP056776:4048386-4048868 [Enterobacter cloacae] [TssD]
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCTGGACTGATAT
TACCTCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGGTGCCGGTAAAGTTAACTTTA
ACGATCTGCACGTTAACGCTCTGATCGACAAATCCACCACAGCAATTCTGAAACACTGCGCCAGCGGTAAACACCTGACC
AAAGTTGAGCTGTCCGTCTGTAAAGCCGGTGGCCAGCAGGTGGAATACTCTCGCATTACCCTGGAAGACGTTCTGGTAAC
GTCTGTTCAGTACACCGGTGCAGACAACGGCGATACCGTTGGTGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGC
AGTACTGGGAGCAGACCACCTCTGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCA
TAA