Detailed information of component protein


Summary

Component ID T6CP210273
Component protein type TssC
T6SS ID (Type) T6SS14097 experimental (Type i3)
Strain Enterobacter cloacae strain DSM 30054
Replicon chromosome
Sequence Protein sequence (500 a.a.); Nucleotide sequence (1500 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) HWQ16_RS19735
Coordinate (Strand) 4046551..4048050 (+)
NCBI ID WP_013096181.1
RefSeq NZ_CP056776
Uniprot ID A0A0F0UYG7_9ENTR, A0A0F1B007_9ENTR, A0A855M3V8_9ENTR, A0A5E1ACS3_9ENTR, A0A8B2SCL8_9ENTR, A0A8B3JNA4_9ENTR, A0A1B3F241_ENTCL, A0A331GPM4_KLEPN, A0A0H3CGU5_ENTCC
KEGG ID ecls:LI67_012785, eclg:EC036_26030, enc:ECL_01540
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 8.5e-137 68..370
VipB_2 PF18945.2 2e-44 380..491

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-499 MSNQTQQHEQQAGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLIAGIDEQLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDQSPIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELANPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYAWANAAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFREREEMERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKLPSLKTKDA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9738 - -



  Protein sequence: 500 a.a.    

>T6CP210273 NZ_CP056776:4046551-4048050 [Enterobacter cloacae] [TssC]
MSNQTQQHEQQAGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLIAGIDEQLSQQ
VNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDQSPIFKKIYEQEYGQFGGEPFG
CIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELANPRDLTKIFQNTEYAAWRSLRESEDARYLG
LVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYAWANAAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFP
SDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFA
HYLKCIVRDKIGSFREREEMERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEG
LTVSLRLVSKLPSLKTKDA*

  Nucleotide sequence: 1500 bp    

>T6CP210273 NZ_CP056776:4046551-4048050 [Enterobacter cloacae] [TssC]
ATGAGCAACCAGACTCAACAACACGAGCAGCAGGCAGGTCAGGCGTTCAGTCAGGACGAGTTCAGCGCACTGCTGAACAA
AGAGTTCCGTCCTAAAACTGACCAGGCGCGTTCCGCCGTCGAGAGCGCGGTAAAAACTCTGGCGCAGCAGGCGCTGGAAA
ACACCGTTACCTTCTCCAACGACACCTATCGCACCATCCAGAACCTGATTGCGGGTATCGACGAACAGCTCTCTCAGCAG
GTGAATCAGATCATTCACCACGAAGAGTTTCAGAAGCTGGAGAGCGCCTGGCGCGGTCTGAGCTATCTTGTGAACAACAC
TGAAACCGACGAGATGCTGAAGATCCGCTTTATGAGCATCTCCAAGCAGGAGCTGGGCCGTACCCTGAAACGCTATAAGG
GTGTGGGCTGGGATCAGAGCCCGATCTTCAAGAAAATCTACGAGCAGGAGTACGGTCAGTTTGGTGGTGAGCCGTTTGGC
TGCATCGTCGGCGACTACTACTTTGACCACAGCCCGCAGGACGTTGAACTGCTGGGTGAAATGGCGCGCATCGGCTCTGC
GGCTCACTGTCCGTTCATCACCGGTACCGCACCGGGCGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCTAACCCACGCG
ATCTGACCAAAATCTTCCAGAACACCGAATACGCCGCCTGGCGTTCACTGCGTGAATCGGAAGATGCCCGCTATCTGGGC
CTGGTGATGCCGCGCTTCCTGTCTCGCCTGCCTTACGGCATTCGTACTAACCCGGTCGACAGCTTTGACTTTGAAGAGCA
GACCGACGGCGCGAACCACAACAGCTACGCCTGGGCGAATGCTGCTTACGCGATGGCGGCCAACATCAACCGCTCTTTCA
AAGAGTACGGCTGGTGCACCTCCATTCGCGGCGTGGAGTCCGGCGGGGCGGTTGAAAACCTGCCGTGCCATACCTTCCCG
AGCGACGACGGCGGCGTGGACATGAAATGTCCGACCGAGATCGCCATCAGCGACCGTCGCGAAGCCGAGCTGGCGAAAAA
TGGCTTTATGCCGCTGGTTCACCGCAAAAACTCCGACTTTGCTGCCTTCATTGGCGCGCAGTCGCTGCAAAAACCGGCCG
AGTACCACGACCCGGATGCCACCGCCAACGCGCGTCTGGCCTCCCGTCTGCCGTACCTGTTCGCCTGCTGCCGCTTTGCG
CATTACCTGAAGTGCATCGTGCGTGACAAAATCGGCTCCTTCCGCGAGCGCGAAGAGATGGAACGCTGGCTGAACGACTG
GGTCATGAACTACGTGGACGGTGACCCGGCTAACTCCTCTCAGGAGACCAAGTCCCGCAAGCCACTGGCCGCTGCAGAAG
TCCAGGTGCAGGAGATTGAAGACAACCCGGGCTACTATGCCGCGAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGT
CTGACCGTTTCTCTGCGTCTGGTATCTAAACTGCCGTCGCTGAAGACGAAAGACGCGTAA