Detailed information of component protein


Summary

Component ID T6CP210268
Component protein type TssL
T6SS ID (Type) T6SS14097 experimental (Type i3)
Strain Enterobacter cloacae strain DSM 30054
Replicon chromosome
Sequence Protein sequence (413 a.a.); Nucleotide sequence (1239 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) HWQ16_RS19710
Coordinate (Strand) 4039325..4040563 (+)
NCBI ID WP_013096177.1
RefSeq NZ_CP056776
Uniprot ID A0A5E1AB49_9ENTR, A0A427KFS7_ENTCL, A0A0H3CGU1_ENTCC
KEGG ID enc:ECL_01535, eclg:EC036_26080
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 1.4e-67 22..223
OmpA PF00691.22 1.8e-14 290..388

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-200 MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLAYEVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMINYCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPAPLSPHPEDRPVLRKLWRPM
Transmembrane helix 201-223 VPLWACVALAGFIACLFYIILNW
Outside 224-412 RLGDNTNPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIDAGLVAVKDEADRSVVILKGDGLFASASTVVRDRYEPVINRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLDRARSVQKMLQGSLSQPDRVKAEGRGEINPVAPNNTPENRARNRRVEITLLVSPENTQAELNGLPQGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9353 - -



  Protein sequence: 413 a.a.    

>T6CP210268 NZ_CP056776:4039325-4040563 [Enterobacter cloacae] [TssL]
MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLAYEVIVGARYCL
CTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMINYCLLLGFEGRYRVLDNGRTQ
LETIKQRLWQMIRGVRGSYPAPLSPHPEDRPVLRKLWRPMVPLWACVALAGFIACLFYIILNWRLGDNTNPVLAKIYQSQ
LPETTIQQPARQLPAVLNLRGFLKPEIDAGLVAVKDEADRSVVILKGDGLFASASTVVRDRYEPVINRIAQAMNNVSGKI
LVVGYSDNVPIRSARFASNYELSLDRARSVQKMLQGSLSQPDRVKAEGRGEINPVAPNNTPENRARNRRVEITLLVSPEN
TQAELNGLPQGN*

  Nucleotide sequence: 1239 bp    

>T6CP210268 NZ_CP056776:4039325-4040563 [Enterobacter cloacae] [TssL]
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGCGTTTACCGGAGCCAGTAGTAACAATCAGCTGGTGGCGGCCGCCAA
TCCGCTGCTCAACGCGATTCCGCAAATCCGTCATTCGGTGTCTCATGACGATCAGGTGGCACTGCGCCAGCGTCTGATCG
ACGAGATTCGCCGTTTTGAAGTCCGCTGCCAGCAGGCAGGGCTGGCTTATGAGGTGATCGTCGGGGCGCGCTATTGCCTC
TGCACGGCGCTGGATGAAGCCGCGGCGCTGACCCCCTGGGGCAGCAGCGGTGTCTGGTCAAGCAATGGTCTGCTGGTCAC
GTTTCATAACGAAACCTGGGGCGGCGAAAAGTTCTTCCAGCTGCTGGCGCGTCTGTCGCAGAACCCGCGTGAACATATCC
TCCTGCTGGAGATGATCAACTACTGCCTGCTGCTCGGTTTCGAAGGGCGCTATCGGGTTCTGGATAATGGCCGCACCCAG
CTGGAAACTATCAAGCAGCGGCTGTGGCAGATGATCCGTGGCGTGCGCGGCAGCTATCCGGCACCGCTCTCTCCACACCC
GGAAGATCGTCCCGTGCTGCGCAAGCTGTGGCGGCCGATGGTGCCGCTGTGGGCCTGTGTCGCGCTGGCCGGGTTTATCG
CCTGCCTGTTCTACATCATTCTCAACTGGCGTCTTGGCGACAACACCAACCCGGTACTGGCGAAGATTTACCAGTCTCAG
TTGCCTGAAACCACCATTCAGCAACCTGCGCGTCAACTGCCTGCGGTGCTTAACCTGCGTGGCTTCCTGAAGCCGGAAAT
CGACGCCGGTCTGGTGGCGGTGAAAGATGAAGCGGATCGCAGCGTGGTGATCCTGAAAGGAGACGGGCTGTTTGCTTCTG
CTTCTACCGTGGTGCGTGACCGCTATGAGCCGGTCATCAACCGGATCGCCCAGGCGATGAACAACGTCAGCGGCAAAATT
CTGGTGGTGGGCTACAGCGATAACGTGCCAATTCGCAGCGCGCGCTTCGCCTCCAACTATGAACTCTCTTTGGATCGCGC
CCGGTCCGTGCAAAAAATGTTGCAGGGAAGCCTCTCCCAGCCTGACCGCGTGAAAGCGGAAGGGCGGGGAGAGATCAATC
CTGTGGCGCCAAACAATACGCCTGAAAACCGCGCCCGTAACCGCCGTGTGGAAATAACTCTGCTGGTGTCGCCTGAAAAT
ACGCAGGCTGAGCTGAACGGATTGCCGCAAGGAAACTAA