Detailed information of component protein


Summary

Component ID T6CP016192
Component protein type TssC
T6SS ID (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (501 a.a.); Nucleotide sequence (1503 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AA098_RS13305
Coordinate (Strand) 2928472..2929974 (-)
NCBI ID WP_003248356.1
RefSeq NZ_CP011525
Uniprot ID I7AZX8_PSEPT, A0A2I0CH73_9PSED, A0A173HEZ5_9PSED, Q88IA0_PSEPK, A0A2L0SYZ6_9PSED, A0A2K4LNU4_9PSED, I3V3X5_PSEPU, A0A1X1AEN5_PSEPU, A5W3P7_PSEP1, A0A2V4FUV1_9PSED, A0A7L9GCV7_9PSED, A0A2N1IWE2_9PSED
KEGG ID ppx:T1E_2458, ppu:PP_3099, ppf:Pput_2623, ppi:YSA_10469
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 1.9e-143 73..374
VipB_2 PF18945.2 1.8e-44 384..494

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-500 MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIAVLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFASRMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRLVAELPQGARG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9899 - -



  Protein sequence: 501 a.a.    

>T6CP016192 NZ_CP011525:c2929974-2928472 [Pseudomonas sp. JY-Q] [TssC]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIAVLDSRIAEID
AMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGG
APFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDS
RYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPT
HTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFAT
SRIAHYMKAIMRDKIGSFASRMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQ
LDELTASLRLVAELPQGARG*

  Nucleotide sequence: 1503 bp    

>T6CP016192 NZ_CP011525:c2929974-2928472 [Pseudomonas sp. JY-Q] [TssC]
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCACCACAGCCCTCGCTGCT
CGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCGCGACCTGATTGGCGAACTGG
TGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCCGTGCTCGATTCGCGCATCGCCGAAATCGAC
GCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCCGCGAGTTCCAGCAGTTGGAAGCCTCCTGGCGCGGCCTGAA
ATACCAGGTAGACCAGACCGAGACCAGCACCACACTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTGCGCG
ACCTGAAGGCCGCCAGCGAATTCGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGC
GCACCTTTCGGCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTCACCGAGATGT
CCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGTTCCGCGCCTCGGAAGACTCG
CGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGTCTGCCGTATGGCCCGGATACCACGCCAGTGGAAGAATTCAA
CTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAATACCTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGCGTCA
CCGACGCCTTCGCCCGCTACGGCTGGTGCGTGGCCATCCGCGGCGTGGAAGGCGGCGGCCTGGTCGAAGGCCTGCCGACC
CATACCTTCAAGACCGACGACGGCGAAATCGCCCTAAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGA
GCTGTCGGACCTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAATACATCTTCGCCACT
TCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTTGCCTCGCGCATGGATGTCGAGCGCTT
CCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTCGACGACACCGCCAGCCAGGAGGCCAAGGCCAAGTTCCCGTTGCGCG
AAGCGCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGGCGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAG
CTGGATGAACTGACCGCCTCGCTGCGGCTGGTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA