Detailed information of component protein


Summary

Component ID T6CP016191
Component protein type TssE
T6SS ID (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AA098_RS13300
Coordinate (Strand) 2927963..2928445 (-)
NCBI ID WP_003248355.1
RefSeq NZ_CP011525
Uniprot ID I7C954_PSEPT, A0A2I0CH93_9PSED, A0A173HF49_9PSED, Q88IA1_PSEPK, A0A2L0SYT8_9PSED, I3V3X4_PSEPU, A0A1X1AEM3_PSEPU, A5W3P8_PSEP1, A0A2V4FJ58_9PSED, A0A2N1IWE5_9PSED
KEGG ID ppf:Pput_2624, ppu:PP_3098, ppi:YSA_10467, ppx:T1E_2457
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 8.9e-14 36..135

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSILEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQVSFDAVLQVNTQEYKVQNLN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9937 - -



  Protein sequence: 161 a.a.    

>T6CP016191 NZ_CP011525:c2928445-2927963 [Pseudomonas sp. JY-Q] [TssE]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSILEYGMPDFIS
RSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQVSFDAVLQVNTQEYKVQNLN
*

  Nucleotide sequence: 483 bp    

>T6CP016191 NZ_CP011525:c2928445-2927963 [Pseudomonas sp. JY-Q] [TssE]
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCCTACCAGTCGGCCGAGCCCGC
AGCGCAGCGCACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTCGAAGTCCTGGTGAACACCCGCCAGT
CCCTGGTCGCCGAAGAGCTCGACGGCTTCAGCCAGCTCGGTGGTTCCATCCTTGAATACGGCATGCCGGACTTCATCAGC
CGCAGCGTGCTCGACCCGCACGATCGTCGCCTGATCCAGCAACAGCTGGAGCGGGCGATCAGCACCGGAGACCGGCGCTT
TCGCCGGGTCCGTGTTCAGCTGTTGGCCCAGCAGAACGGCCATCGCATGTTGACCTTCCGCGTGGACGCCGTATTGCGTC
TGCAGGACATCAGCCGCCAGGTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAAC
TGA