Detailed information of component protein


Summary

Component ID T6CP016189
Component protein type TssG
T6SS ID (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (357 a.a.); Nucleotide sequence (1071 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AA098_RS13290
Coordinate (Strand) 2925109..2926179 (-)
NCBI ID WP_003248350.1
RefSeq NZ_CP011525
Uniprot ID A0A2I0CH70_9PSED, A0A173HFK0_9PSED, Q88IA3_PSEPK, A0A1Y5KXG0_PSEPU, A0A2V4FJR9_9PSED
KEGG ID ppu:PP_3096
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 6.2e-104 19..333

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-356 MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQLGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9820 - -



  Protein sequence: 357 a.a.    

>T6CP016189 NZ_CP011525:c2926179-2925109 [Pseudomonas sp. JY-Q] [TssG]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVS
PAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFD
GYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQLG
RRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGR
SGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL*

  Nucleotide sequence: 1071 bp    

>T6CP016189 NZ_CP011525:c2926179-2925109 [Pseudomonas sp. JY-Q] [TssG]
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCGAATTCTTTCA
ATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCGGCCGCACGAAGACCCGCTGC
GTTTTCGTACCCAGTTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGACCTGCACTTCGAGCGCGAAGGCAAGGTGTCG
CCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCATGGGCCTGGTCGGGCCGTCGGGCGTGCTGCCACGCCCGTA
CACCGAGCTGCTGCTCGAGCGCCACGTGCAGTATCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCA
TGACCACGCTGTTCTACGAGGCCTGGCAAAAATACAAATTCCACATCGAGCACGAGCGCAATGGCACTTCGGGCTTCGAC
GGCTACCTGCTCAACCTGGTTGGCCTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCG
TGAGCTGTTCAGCTATTTTGCCGGCCTGCTCAGCCAGAAACCGCGCAATGCGCTGAACCTTGAACGCATGCTCGGTTTCT
ATTTCTCGCTGCCGATCAAGGTCCAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCGAACAATGCACCCAGCTTGGC
CGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTGGGACTACCAGTCGTGCATCCGCATCGAGCT
GGGCCCGCTGAGCCTGGCCGACTACCAGCGCTTCCAGCCGGGCACCGCCTGCTACCGCAAGCTGGTCGAGCTCGTGCGCT
TCTATATAGGTGCCGAGCTGGATTTCGAAATTGCCCCGCGCCTCAAGCGCGAGGCGGTGCCACGCGCCCAACTGGGCCGC
AGCGGCAATGTCGCCCTGGGCTGGCTGGGTTGGCTCAAACGCCCGGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTT
CCACATTCCTTACGATGGGGTCGCCTTGTGA