Detailed information of component protein


Summary

Component ID T6CP016186
Component protein type TssK
T6SS ID (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (448 a.a.); Nucleotide sequence (1344 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AA098_RS13275
Coordinate (Strand) 2920428..2921771 (-)
NCBI ID WP_003248343.1
RefSeq NZ_CP011525
Uniprot ID I7C950_PSEPT, A0A173HF66_9PSED, A0A2L0SYV7_9PSED, A0A2K4LNV1_9PSED, I3V3W9_PSEPU, A0A550F8K2_PSEPU, A5W3Q3_PSEP1, A0A7L9GCU3_9PSED
KEGG ID ppx:T1E_2452, ppi:YSA_10459, ppf:Pput_2629
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 8.5e-136 19..445

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-447 MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFPDGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEGELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNVDPHFVHPTLHLGSHETIAGIGKRLLGALQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLTFTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYIAVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGTVYERMISAQAICFYAPSAFTNLKLELMAVLK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9924 - -



  Protein sequence: 448 a.a.    

>T6CP016186 NZ_CP011525:c2921771-2920428 [Pseudomonas sp. JY-Q] [TssK]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRSTPFHWGVQALQVDEDALANGSLQLKRLKLVFPDGSLYDAPQH
DPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEGELENEITSLRLNVVLLVDGD
SLDGYSHCPLAKLTRNSMGGFNVDPHFVHPTLHLGSHETIAGIGKRLLGALQAKSKALSGRRRERADQIAEFGSSDVTLF
WLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLTFTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQ
CIVINLTQTKPSHWQGQLHDPRLAEADFYIAVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAI
PVRLDNQYFAIEPHGTVYERMISAQAICFYAPSAFTNLKLELMAVLK*

  Nucleotide sequence: 1344 bp    

>T6CP016186 NZ_CP011525:c2921771-2920428 [Pseudomonas sp. JY-Q] [TssK]
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTATCAGGACGAATTCCA
TCAGCACCAGTTGGCTGAGGCGACCCTGCGCAGCACCCCTTTCCATTGGGGGGTTCAGGCGCTGCAGGTGGACGAGGACG
CCCTGGCCAATGGTTCACTGCAGCTCAAGCGCCTGAAGCTGGTGTTCCCCGATGGCAGCCTCTACGACGCGCCGCAGCAC
GATCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCAAGGCCAACGACCTGAAGGTGTATGCTGCGCTCAAGCTGCC
CGAGCCATTCGGCCTCAACTACGTCGAGGATGGCCACGAACACAAGGCCGCACGGCGTTTCCGCAAGCAGTTCGACACCC
TGCCCGACCTTAATGAAGGCGAGCTGGAAAACGAAATCACCAGCTTGCGCCTGAACGTCGTACTGCTGGTCGACGGTGAC
AGCCTCGACGGTTACAGCCACTGCCCACTGGCCAAGCTGACACGCAACAGCATGGGCGGTTTCAACGTTGACCCACATTT
CGTCCACCCCACCTTGCACCTGGGCAGCCATGAGACCATTGCCGGCATCGGCAAGCGCCTGCTCGGCGCCCTGCAGGCCA
AGAGCAAGGCGCTTTCCGGCCGACGCCGCGAGCGCGCCGACCAGATCGCCGAGTTCGGCTCCAGCGATGTGACCCTGTTC
TGGCTGCTGAACACGGTCAACCGTGCCCACCCGCAGCTGGCGCATCTACTGGCCCACCCGCGCCTGCACCCGGAGCGCCT
GTACCTGTTCCTGGCGGACCTTGCCGGCGGCCTGCTGACCTTCACCCTGGACACCCAGCTCAGCGACATCCCCGAGTACG
ACCACCACGACCCGGCCGCGTCGCTGGTCAAGCTCGACGAAATGATCCGGGTGATGCTCGACAACGTCGTGCCCAACCAG
TGCATTGTCATCAACCTGACCCAGACCAAGCCATCGCACTGGCAAGGCCAACTGCACGACCCGCGCCTGGCCGAAGCCGA
CTTCTATATCGCCGTGCACGCCGACATGCCCGGCGCCAGCCTGCTGGAGCTGGTGCCCCGTGCCTTCAAGGTCGGTTCGC
CGGAAGACATTGAAGTGGTGGTCAACAGCGCCATGCCGGGTGTCACCCTCAATCATGCCGCGCGGCTGCCGAACGCGATT
CCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAACCACACGGCACTGTGTATGAGCGAATGATCAGCGCCCAGGCCAT
CTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGGCGGTGCTCAAATGA