Detailed information of component protein


Summary

Component ID T6CP016181
Component protein type TssD
T6SS ID (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AA098_RS13250
Coordinate (Strand) 2911822..2912340 (-)
NCBI ID WP_003248334.1
RefSeq NZ_CP011525
Uniprot ID A0A2I0CH82_9PSED, A0A173HF41_9PSED, A0A2L0SYV1_9PSED, A0A1Y5KXH7_PSEPU
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.5e-40 6..145

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFVAGGNQSGEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9734 - -



  Protein sequence: 173 a.a.    

>T6CP016181 NZ_CP011525:c2912340-2911822 [Pseudomonas sp. JY-Q] [TssD]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAKLFEHCCTGKH
IAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFVAGGNQSGEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIV
GGWDRTANKVFA*

  Nucleotide sequence: 519 bp    

>T6CP016181 NZ_CP011525:c2912340-2911822 [Pseudomonas sp. JY-Q] [TssD]
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGCGAAGTACTGGATGAAAAACACAAGGACTGGATCGAAGT
GCTGGGCTACGAGTACGGCGCCACCCAGGCTACGTCGGCAACCGCCAGCTCTTCGGGCGGTGCGTCCTCCGAGCGCGTTG
CCCTGAGCGACTTCAAGATCCGCAAGGCAGTCGACAAGGCATCGGCCAAACTGTTCGAACACTGCTGCACCGGCAAGCAC
ATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGCGACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGT
GGTCTCTTCGGTCAGGTTTGTCGCCGGTGGCAACCAGAGTGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAAGAAA
TCAGCTTCAACTTTGCCCGCATCAAAACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCCGGCGGCAACATCGTA
GGTGGCTGGGACCGCACCGCGAACAAAGTGTTTGCCTAA