Detailed information of component protein


Summary

Component ID T6CP016070
Component protein type TssE
T6SS ID (Type) T6SS00935 experimental (Type i2)
Strain Escherichia coli 17-2
Replicon chromosome
Sequence Protein sequence (144 a.a.); Nucleotide sequence (432 bp)
Reference
[1] Aschtgen MS, Bernard CS, De Bentzmann S, et al. SciN is an outer membrane lipoprotein required for type VI secretion in enteroaggregative Escherichia coli. J Bacteriol. 2008 Nov;190(22):7523-31. doi: 10.1128/JB.00945-08. Epub 2008 Sep 19. PMID: 18805985
[2] Aschtgen MS, Gavioli M, Dessen A, et al. The SciZ protein anchors the enteroaggregative Escherichia coli Type VI secretion system to the cell wall. Mol Microbiol. 2010 Feb;75(4):886-99. doi: 10.1111/j.1365-2958.2009.07028.x. PMID: 20487285
[3] Felisberto-Rodrigues C, Durand E, Aschtgen MS, et al. Towards a structural comprehension of bacterial type VI secretion systems: characterization of the TssJ-TssM complex of an Escherichia coli pathovar. PLoS Pathog. 2011 Nov;7(11):e1002386. doi: 10.1371/journal.ppat.1002386. Epub 2011 Nov 10. PMID: 22102820
[4] Durand E, Zoued A, Spinelli S, et al. Structural characterization and oligomerization of the TssL protein, a component shared by bacterial type VI and type IVb secretion systems. J Biol Chem. 2012 Apr 20;287(17):14157-68. doi: 10.1074/jbc.M111.338731. Epub 2012 Feb 27. PMID: 22371492
[5] Aschtgen MS, Zoued A, Lloubès R, et al. The C-tail anchored TssL subunit, an essential protein of the enteroaggregative Escherichia coli Sci-1 Type VI secretion system, is inserted by YidC. Microbiologyopen. 2012 Mar;1(1):71-82. doi: 10.1002/mbo3.9. PMID: 22950014
[6] Zoued A, Durand E, Bebeacua C, et al. TssK is a trimeric cytoplasmic protein interacting with components of both phage-like and membrane anchoring complexes of the type VI secretion system. J Biol Chem. 2013 Sep 20;288(38):27031-27041. doi: 10.1074/jbc.M113.499772. Epub 2013 Aug 6. PMID: 23921384
[7] Brunet YR, Espinosa L, Harchouni S, et al. Imaging type VI secretion-mediated bacterial killing. Cell Rep. 2013 Jan 31;3(1):36-41. doi: 10.1016/j.celrep.2012.11.027. Epub 2013 Jan 3. PMID: 23291094
[8] Nguyen VS, Logger L, Spinelli S, et al. Inhibition of type VI secretion by an anti-TssM llama nanobody. PLoS One. 2015 Mar 26;10(3):e0122187. doi: 10.1371/journal.pone.0122187. eCollection 2015. PMID: 25811612
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) H1D38_RS04375
Coordinate (Strand) 915218..915649 (-)
NCBI ID 447060676
RefSeq NZ_JACEFV010000001
Uniprot ID D3GUX6_ECO44
KEGG ID elo:EC042_4545
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 6.2e-15 32..114

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-143 MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTAHQLMRVLSDVLLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRYVQT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9918 - -



  Protein sequence: 144 a.a.    

>T6CP016070 NZ_JACEFV010000001:c915649-915218 [Escherichia coli] [TssE]
MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTAHQLMRVLSDV
LLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRYVQT*

  Nucleotide sequence: 432 bp    

>T6CP016070 NZ_JACEFV010000001:c915649-915218 [Escherichia coli] [TssE]
ATGCCGCGTCCTTCCCTTTATGAAATTCTCTATGGCAATTTCACTGGCGGGCTGGAGTTAAACCAGGTCGGTGAGGAAGA
GCAGGTTATTCTTTCGGTGCTCGATAACATGCAGCGTATTCTGAATACCCGTGCCGGAAGCCTTAAGCATCTTCCGGATT
ATGGTCTGCCGGATATAACAACCATTCTGCAGGGAATGCCGGGGACGGCGCATCAACTGATGCGCGTGCTTTCAGACGTT
CTGCTGAAGTATGAGCCACGTATTAAGCGCGTCGACGTGACGATGCAGGAACAGACTCAGCCTGGTGAGTTGCATTATGT
CATTGATGCAGAACTTAAAGATGCCGGGCTGGTTCGTTACGGAACAACATTTATACCGGAGGGCAGGGTGTTGTTGCGCC
ATCTGAAACAGCAGCGCTACGTGCAGACGTGA