Detailed information of component protein
Summary
External database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 891802..892353 (-) |
| NCBI ID | 446074892 |
| RefSeq | NZ_JACEFV010000001 |
| Uniprot ID | UPI0002514EFB |
| KEGG ID | - |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-183 | MTIKCLLLAVMVFPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFLQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVVAGYYPFPGKQHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| LIPO(Sec/SPII) | 0.9937 | pos: 19-20. ITA-CS. | MTIKCLLLAVMVFPFFITA |
Protein sequence: 184 a.a.
Nucleotide sequence: 552 bp