Detailed information of component protein
Summary
| Component ID | T6CP016036 |
| Component protein type | TssJ |
| T6SS ID (Type) | T6SS01208  (Type i1) |
| Strain | Aeromonas veronii strain TH0426 |
| Replicon | chromosome |
| Sequence | Protein sequence (172 a.a.); Nucleotide sequence (516 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2471305..2471820 (-) |
| NCBI ID | WP_064336280.1 |
| RefSeq | NZ_CP012504 |
| Uniprot ID | A0A2S3XL12_9GAMM |
| KEGG ID | avo:AMS64_11295 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-171 | MIRALMLGAALLTLAGCTTMGKMADVAMNPDIQVGSNDDQPSTLGLSLLAEPDVNPNESGEAAPIEFQVVVLAEDSKLLATDYDQVTADVEKALGKNYLDHQDYTLLPGQFKYLPPVKLDEKTRYIGVIARYADPDSAEWRKVIKVKSKGTAYQILVHLRLDEVELQKEEE |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| LIPO(Sec/SPII) | 0.9974 | pos: 16-17. LAG-CT. | MIRALMLGAALLTLAG |
Protein sequence: 172 a.a.
Nucleotide sequence: 516 bp