Detailed information of component protein


Summary

Component ID T6CP016032
Component protein type TssA
T6SS ID (Type) T6SS01208 experimental (Type i1)
Strain Aeromonas veronii strain TH0426
Replicon chromosome
Sequence Protein sequence (476 a.a.); Nucleotide sequence (1428 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene)
Coordinate (Strand) 2462920..2464347 (-)
NCBI ID WP_064336276.1
RefSeq NZ_CP012504
Uniprot ID A0A2S3XL13_9GAMM
KEGG ID avo:AMS64_11265
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-475 MSYQHPWCSRLLTSLPDAQIKGAVLVDEPRWDYVETELVKLGSLAHSQVDLNAVAEACLGLLESRTKDMRVLAQLLRCLQHPAKATPMGAALSLLEAWIKAYWLLAWPGNATQKQRLMVQIIKRFEGALPRVSESASAAELAQLLAQAEQLEAVWLAQCPDKGELLDPLVMGLKRAQRQQVAQAQADAGGQPASSSAAATASASGMAGTMVLSGSSKGSGVEIDSSNDRAWRQTQLKVAELLIERQPEAAIGYRLRRHAIWAGITTPPITAQGNKTQLASMSADMVDEYRAAMGTPDLALWQRIEQSLTLAPYWFEGHRLSAEVAQKLGYGVVAQAIMAELDAFLQRLPALRDLTFSDGSPFLSPECSRWLQPAKSSGGGSGQAELAEEVALRHGEQGIAAALALLDERMAQMKEPRARFHALLVQAELLEQEGMEALARQQYQHLWQEADRLGLSQWEPGLVSRLAPYATHLPK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9949 - -



  Protein sequence: 476 a.a.    


  Nucleotide sequence: 1428 bp