Detailed information of component protein


Summary

Component ID T6CP016009
Component protein type TssK
T6SS ID (Type) T6SS01290 experimental (Type i1)
Strain Vibrio cholerae DL4215
Replicon chromosome
Sequence Protein sequence (445 a.a.); Nucleotide sequence (1335 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BL246_RS05955
Coordinate (Strand) 81728..83062 (+)
NCBI ID 446380152
RefSeq NZ_MOLM01000011
Uniprot ID Q9KN51_VIBCH, A0A0X1L1V1_VIBCO, D7HAU6_VIBCL, A0A0K9UXP9_VIBCL, A0A0H3Q276_VIBCL, C3LUD8_VIBCM, A0A023PT89_VIBCL
KEGG ID vcx:VAA049_1794, vcz:VAB027_915, vch:VC_A0114, vcq:EN18_04295, vcm:VCM66_A0112
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 6.1e-156 19..442

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-444 MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMPDGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTHSSGFAFHVAAAFDDLELQFWAIRS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9947 - -



  Protein sequence: 445 a.a.    

>T6CP016009 NZ_MOLM01000011:81728-83062 [Vibrio cholerae] [TssK]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMPDGTTFRIPQE
DHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDR
SAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQA
LNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSI
QLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYH
AGYTYYQLDKTSAAWAMLTHSSGFAFHVAAAFDDLELQFWAIRS*

  Nucleotide sequence: 1335 bp    

>T6CP016009 NZ_MOLM01000011:81728-83062 [Vibrio cholerae] [TssK]
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGCAGAGATATAC
GGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGAGTTGTCGCTCAACCCGGAAT
ACCTCTCGTTTGGCCGTATTGCGATTGAGCGAGCGGTCGGCGTGATGCCCGATGGCACCACCTTTCGTATTCCTCAAGAA
GATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCATTGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAG
TGAGTCGCTGATGGAGATTAACTGGCCAGAAGAGCGCGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATG
TCCACAGCGTGCAAGGTGATACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGC
AGTGCGTATGCCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGCGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTGGTAGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATGCGTGAGCGAG
CGAAAAATATTGCTCAGCGGATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGGACTTTATGCTGCTGCAAGCT
TTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTTACACCCAGAGCGTCTGTTTGAATGTCTCTC
GTGTGTGTGTGGTGAGCTGGCTACCTTTACGGACGAAAGTCGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCAC
CCAGCCACTCTTTCCAGCCGCTGATCCGCAGCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGTGCCGTCTCTATC
CAACTGGATAAACGTAAGTACGGTTTGATGGTTGCGCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCAT
CGCTGTTAAAGCTCGCATGCCGTTGGATGAGCTACGTCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCATTACCGGTCGCACCGCGCCAATTGCCTTACCAC
GCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCATTCCAGCGGTTTTGCGTTCCA
CGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGAGCTAA