Detailed information of component protein


Summary

Component ID T6CP016002
Component protein type TssB
T6SS ID (Type) T6SS01290 experimental (Type i1)
Strain Vibrio cholerae DL4215
Replicon chromosome
Sequence Protein sequence (169 a.a.); Nucleotide sequence (507 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BL246_RS05920
Coordinate (Strand) 74535..75041 (+)
NCBI ID WP_000031391.1
RefSeq NZ_MOLM01000011
Uniprot ID Q9KN58_VIBCH, A0A0X1L1S0_VIBCO, D7HAV3_VIBCL, A0A0K9UVI4_VIBCL, A0A7U8ZSI9_VIBCL, A0A0H3QAN1_VIBCL, C3LUD1_VIBCM, A0A085TAW9_VIBCL
KEGG ID vcm:VCM66_A0105, vcq:EN18_04260, vcx:VAA049_1801, vcz:VAB027_922, vch:VC_A0107
PDB ID 3J9G, 5MXN, 5MYU, 5OJQ

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 1.1e-56 6..157

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-168 MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9881 - -



  Protein sequence: 169 a.a.    

>T6CP016002 NZ_MOLM01000011:74535-75041 [Vibrio cholerae] [TssB]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESELKITATVKNK
LTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLL
SGQEEPQA*

  Nucleotide sequence: 507 bp    

>T6CP016002 NZ_MOLM01000011:74535-75041 [Vibrio cholerae] [TssB]
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATGCACAGGCTGA
GGTTGAGCTACCACTCAAAACCCTGGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAACCCCATTGGAAGAGCGTGCAA
CAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAGCTGAAAATCACCGCCACGGTGAAAAACAAG
CTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCAATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGC
ATCACAAGTTCCAGAACTGAAAAAATTGATTGAGTTGCGTGAAGCGTTAGTTGCCCTCAAAGGGCCGCTAGGCAACATTC
CCGCATTTCGTGAGCGTTTACAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAACTGTTGGCAGAACTGAATCTGCTC
AGTGGTCAAGAAGAGCCACAAGCGTAA