Detailed information of component protein
Summary
| Component ID | T6CP015913 |
| Component protein type | TssB |
| T6SS ID (Type) | T6SS01281  (Type i1) |
| Strain | Vibrio coralliilyticus OCN008 |
| Replicon | chromosome II |
| Sequence | Protein sequence (170 a.a.); Nucleotide sequence (510 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 1640957..1641466 (+) |
| NCBI ID | WP_006961144.1 |
| RefSeq | NZ_CP048694 |
| Uniprot ID | A0A086WMI7_9VIBR, A0A097AXY0_9VIBR, A0A6B8NI90_9VIBR, A0A649YYQ8_9VIBR |
| KEGG ID | vct:JV59_19710 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-169 | MSRDGSVAPKERINIRYVPATGDAQEDVELPLNMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGYAPNLKVNVENRLTDEEGAQLGVDLTFTNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKIAAVLQDEEARKKLLEELSIGENQDAEKAE |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9860 | - | - |
Protein sequence: 170 a.a.
Nucleotide sequence: 510 bp