Detailed information of component protein


Summary

Component ID T6CP015907
Component protein type TssL
T6SS ID (Type) T6SS01280 experimental (Type i5)
Strain Vibrio coralliilyticus OCN008
Replicon chromosome I
Sequence Protein sequence (402 a.a.); Nucleotide sequence (1206 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) G3U99_RS13205
Coordinate (Strand) 2782920..2784125 (+)
NCBI ID WP_031343073.1
RefSeq NZ_CP048693
Uniprot ID A0A7Y3Z134_9VIBR
KEGG ID vcy:IX92_06555
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 5.6e-38 53..243
SPOR PF05036.15 2.9e-06 316..384

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-229 MDYLDEETLVWDTNKSDFTDKNNDENTSRWVSVNASKNHHEFLNYFDKAENQLINISSELLSTTLKVSTLPEPEDVTTLRHQLVSNINEIKAKGAELTYPVAVIDKLCFLYAVVLDELIIYSEWGEKRGWENKTLLSELFGMRNGGELFFTVAEKATRQPHKLIDLLEVIYIFLNIGFKGQYRESGSEQLKSFIHQLEQVISQYRQSNSIHCRTRVKQPKARKPTRRKR
Transmembrane helix 230-252 YLLTTLFFSTLIALSIGLTHFWY
Outside 253-401 EKTMPQRARDFNFLPDFSERYVLSGEVNDIVFISNDDDLVNTPQRASKVEMVDATPPPSMLTSKSEWLVQLATFSSQKNADAFISTLSPSAYTPIVEQFHSFYRVIVRSESSQQAREIKAWYLEKDAIKAIIVQNKKTIKDTKKTSEAP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9890 - -



  Protein sequence: 402 a.a.    

>T6CP015907 NZ_CP048693:2782920-2784125 [Vibrio coralliilyticus OCN008] [TssL]
MDYLDEETLVWDTNKSDFTDKNNDENTSRWVSVNASKNHHEFLNYFDKAENQLINISSELLSTTLKVSTLPEPEDVTTLR
HQLVSNINEIKAKGAELTYPVAVIDKLCFLYAVVLDELIIYSEWGEKRGWENKTLLSELFGMRNGGELFFTVAEKATRQP
HKLIDLLEVIYIFLNIGFKGQYRESGSEQLKSFIHQLEQVISQYRQSNSIHCRTRVKQPKARKPTRRKRYLLTTLFFSTL
IALSIGLTHFWYEKTMPQRARDFNFLPDFSERYVLSGEVNDIVFISNDDDLVNTPQRASKVEMVDATPPPSMLTSKSEWL
VQLATFSSQKNADAFISTLSPSAYTPIVEQFHSFYRVIVRSESSQQAREIKAWYLEKDAIKAIIVQNKKTIKDTKKTSEA
P*

  Nucleotide sequence: 1206 bp    

>T6CP015907 NZ_CP048693:2782920-2784125 [Vibrio coralliilyticus OCN008] [TssL]
ATGGACTACTTAGACGAAGAAACACTGGTTTGGGACACAAACAAGTCTGACTTTACCGACAAGAACAACGATGAAAACAC
ATCTCGCTGGGTGTCGGTTAATGCCAGTAAAAACCATCATGAGTTTCTGAATTACTTTGATAAAGCAGAAAACCAGTTAA
TCAATATCAGCAGTGAGTTACTGTCAACGACATTAAAAGTATCAACGCTGCCAGAACCAGAAGATGTCACAACACTTCGC
CACCAGCTTGTAAGTAATATCAATGAAATCAAAGCCAAAGGTGCAGAGTTAACTTACCCTGTAGCGGTTATTGATAAACT
CTGCTTCCTATATGCCGTTGTTTTAGATGAGCTAATTATCTACAGCGAATGGGGAGAAAAACGCGGCTGGGAAAATAAAA
CCCTGCTCAGCGAATTATTCGGTATGAGAAATGGCGGTGAATTGTTTTTCACCGTTGCGGAAAAAGCAACGAGACAGCCT
CATAAATTGATCGATCTGCTTGAAGTCATATACATATTCCTCAACATCGGCTTCAAAGGTCAATATAGGGAATCGGGCAG
TGAACAGTTAAAGAGCTTCATTCATCAGCTAGAGCAAGTCATCAGCCAATACCGCCAAAGCAACAGCATTCACTGCCGGA
CTCGAGTAAAACAGCCTAAAGCACGTAAGCCAACACGCAGAAAACGCTATCTGCTAACGACACTATTTTTCAGTACTTTG
ATTGCGCTGAGTATAGGCTTAACTCACTTCTGGTATGAAAAAACAATGCCACAGCGCGCACGAGACTTTAACTTCTTACC
GGACTTTAGCGAACGTTACGTCTTATCAGGTGAAGTTAACGATATCGTCTTTATCAGCAACGATGATGATTTGGTAAATA
CTCCGCAACGAGCTAGCAAAGTAGAGATGGTCGATGCAACTCCACCACCTTCAATGCTGACCAGCAAGTCAGAATGGTTG
GTGCAATTGGCAACGTTCTCGTCACAGAAAAATGCAGACGCATTTATAAGCACATTGTCCCCATCCGCTTACACGCCTAT
CGTAGAGCAGTTTCACTCCTTTTATCGGGTCATTGTTCGCAGCGAATCCTCTCAACAAGCCAGAGAGATTAAAGCTTGGT
ATTTAGAAAAAGACGCAATCAAAGCCATCATTGTGCAAAACAAAAAAACAATAAAAGACACTAAGAAAACTTCAGAGGCT
CCTTAG