Detailed information of component protein


Summary

Component ID T6CP015906
Component protein type TssK
T6SS ID (Type) T6SS01280 experimental (Type i5)
Strain Vibrio coralliilyticus OCN008
Replicon chromosome I
Sequence Protein sequence (444 a.a.); Nucleotide sequence (1332 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) G3U99_RS13200
Coordinate (Strand) 2781583..2782914 (+)
NCBI ID WP_006962077.1
RefSeq NZ_CP048693
Uniprot ID A0A086WRM6_9VIBR, A0A7Y3Z0R3_9VIBR, A0A6B8N6M0_9VIBR, A0A649YPE1_9VIBR
KEGG ID vct:JV59_31965, vcy:IX92_06560
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.6e-104 19..441

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-443 VDAFKKVVWQEGMFIAPQHFQQQDRYVQNYVRQNIETLAGFAPFYGVTELTINHDLLKIGKLSVASSAGVFPDGTQFELKEEVARDIPQGTIETIAYLALPISLQGNNDYGSDESEQSRYVTQSISVFDTSTSENASVEIDVAQLNISIKLEGEDTSGFTLIPISKILESSESGDVVLDRAFIPACLHYGASTLLVERMKEIHALSSNRATNLLKRIQAGQGQKSPQSMMQDYLWLQTLNTWLPWFDLTINNPKFQTHDLYLELRKFEAQVMALTPAIPEPCSNLQYHRLYDSFNPLFSSLRNMLTLVQQDSVIEFNWDSSLFERRRLLRTLIKDTASVSNRRFVLAVKSNISSAELNELFPVSAKLGNNARIVELVRNSLSGIALSPLPVAPSELKPMQGVSYFEVDTSDRMWLEMLENRDAIAMHVDTRISELEVMLYALR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9935 - -



  Protein sequence: 444 a.a.    

>T6CP015906 NZ_CP048693:2781583-2782914 [Vibrio coralliilyticus OCN008] [TssK]
VDAFKKVVWQEGMFIAPQHFQQQDRYVQNYVRQNIETLAGFAPFYGVTELTINHDLLKIGKLSVASSAGVFPDGTQFELK
EEVARDIPQGTIETIAYLALPISLQGNNDYGSDESEQSRYVTQSISVFDTSTSENASVEIDVAQLNISIKLEGEDTSGFT
LIPISKILESSESGDVVLDRAFIPACLHYGASTLLVERMKEIHALSSNRATNLLKRIQAGQGQKSPQSMMQDYLWLQTLN
TWLPWFDLTINNPKFQTHDLYLELRKFEAQVMALTPAIPEPCSNLQYHRLYDSFNPLFSSLRNMLTLVQQDSVIEFNWDS
SLFERRRLLRTLIKDTASVSNRRFVLAVKSNISSAELNELFPVSAKLGNNARIVELVRNSLSGIALSPLPVAPSELKPMQ
GVSYFEVDTSDRMWLEMLENRDAIAMHVDTRISELEVMLYALR*

  Nucleotide sequence: 1332 bp    

>T6CP015906 NZ_CP048693:2781583-2782914 [Vibrio coralliilyticus OCN008] [TssK]
GTGGACGCATTCAAAAAAGTAGTATGGCAAGAAGGTATGTTCATTGCCCCACAACATTTTCAGCAGCAGGATCGATATGT
CCAAAATTACGTTCGTCAAAATATCGAGACCTTGGCAGGATTTGCTCCCTTTTATGGTGTGACTGAATTAACCATCAATC
ACGATCTACTTAAAATTGGTAAACTCTCGGTAGCTTCATCAGCGGGTGTCTTCCCTGATGGAACTCAATTTGAGCTGAAA
GAAGAGGTCGCCAGAGATATTCCTCAAGGAACAATAGAAACCATTGCTTATCTCGCCCTACCAATATCTTTGCAAGGCAA
CAATGACTATGGCAGTGATGAGTCAGAGCAGAGTCGCTATGTCACACAGTCCATCAGTGTTTTCGACACATCAACGTCAG
AAAATGCAAGTGTCGAAATAGATGTTGCCCAGCTGAACATTTCTATCAAGCTTGAGGGTGAAGATACGTCCGGTTTTACC
TTGATTCCTATTTCTAAAATTCTGGAAAGCAGCGAATCAGGAGATGTGGTACTGGATCGAGCATTTATTCCTGCCTGTCT
TCACTACGGCGCTTCGACATTATTGGTTGAGCGCATGAAAGAGATCCACGCTCTTTCTTCCAACAGAGCAACAAATCTGC
TCAAGCGAATCCAAGCTGGACAGGGACAGAAGAGCCCTCAGTCTATGATGCAAGATTACCTTTGGTTGCAGACTTTAAAT
ACATGGCTGCCGTGGTTTGATCTCACCATCAATAACCCTAAGTTCCAGACGCATGATTTGTACCTCGAACTGAGAAAGTT
TGAAGCACAGGTAATGGCTCTGACGCCGGCAATCCCTGAGCCATGTAGCAATCTTCAGTACCACAGGCTGTATGATAGCT
TTAATCCTCTGTTCTCTAGTTTGCGTAATATGCTTACTCTGGTCCAACAGGACTCTGTTATCGAGTTCAATTGGGACTCC
TCTTTGTTCGAACGTCGTCGCTTGTTACGTACACTGATTAAGGATACGGCAAGCGTCTCTAATCGCCGATTCGTGCTTGC
CGTTAAGTCAAATATAAGTAGTGCTGAACTTAATGAGCTGTTCCCCGTTTCTGCCAAGCTGGGTAACAACGCGCGCATTG
TTGAGCTAGTGAGAAACAGTTTATCAGGTATAGCGCTCTCCCCGCTGCCTGTTGCGCCAAGTGAATTAAAGCCGATGCAA
GGGGTTTCTTACTTCGAAGTGGATACCTCCGATAGGATGTGGCTTGAGATGCTTGAAAACCGTGATGCTATTGCAATGCA
TGTAGATACACGCATTAGTGAATTAGAAGTCATGTTGTACGCGTTGAGATAA