Detailed information of component protein


Summary

Component ID T6CP015903
Component protein type TssG
T6SS ID (Type) T6SS01280 experimental (Type i5)
Strain Vibrio coralliilyticus OCN008
Replicon chromosome I
Sequence Protein sequence (310 a.a.); Nucleotide sequence (930 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) G3U99_RS13165
Coordinate (Strand) 2772239..2773168 (+)
NCBI ID WP_006962084.1
RefSeq NZ_CP048693
Uniprot ID A0A086WRN3_9VIBR, A0A7Y4F8B5_9VIBR, A0A6B8N9Y1_9VIBR, A0A649YPC6_9VIBR
KEGG ID vct:JV59_31930
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 1.5e-40 11..294

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-309 MSFINDLTQHPQQYDFAQAMRLLTHWINQTPNRVKLVLKAEAMPTGDASEIQYFSLKNNRLKLRLAKQALSGVKGVIPNYIYEELLAALHNDDHALKDFLDVFNQRYFEIVSQLETGSWLVVQNELYPAKTALLNHIATLKKNHGKYFQYSMLLSQGQRSLSTLSQMLNDYFPFAIQVSTKTHERRQLPSDSLTRLGQKEHFNSRVGQGFLIGKTCLTHFSHLIVSITPKTENELIAIQSDPLLASNMKELIQHYLKDNTPTSVYLNVKREYLNRPRLSSNKYNAAKLGEVDCLAPERKPQQIVSILLK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9936 - -



  Protein sequence: 310 a.a.    

>T6CP015903 NZ_CP048693:2772239-2773168 [Vibrio coralliilyticus OCN008] [TssG]
MSFINDLTQHPQQYDFAQAMRLLTHWINQTPNRVKLVLKAEAMPTGDASEIQYFSLKNNRLKLRLAKQALSGVKGVIPNY
IYEELLAALHNDDHALKDFLDVFNQRYFEIVSQLETGSWLVVQNELYPAKTALLNHIATLKKNHGKYFQYSMLLSQGQRS
LSTLSQMLNDYFPFAIQVSTKTHERRQLPSDSLTRLGQKEHFNSRVGQGFLIGKTCLTHFSHLIVSITPKTENELIAIQS
DPLLASNMKELIQHYLKDNTPTSVYLNVKREYLNRPRLSSNKYNAAKLGEVDCLAPERKPQQIVSILLK*

  Nucleotide sequence: 930 bp    

>T6CP015903 NZ_CP048693:2772239-2773168 [Vibrio coralliilyticus OCN008] [TssG]
ATGTCATTCATTAACGACCTAACTCAGCACCCGCAGCAATACGACTTCGCTCAAGCGATGAGATTGTTGACGCATTGGAT
TAATCAGACTCCGAACCGAGTTAAGCTTGTGCTGAAAGCAGAAGCGATGCCAACAGGTGATGCCAGCGAAATTCAGTACT
TCTCTCTGAAGAATAATCGACTCAAGTTGAGATTGGCAAAACAAGCTTTATCAGGTGTAAAAGGGGTTATACCTAACTAC
ATATACGAGGAGCTGTTAGCGGCTTTACACAACGATGACCATGCTTTAAAAGACTTTCTTGATGTCTTCAATCAGCGATA
TTTCGAAATTGTCAGCCAACTAGAAACGGGGTCATGGCTTGTCGTACAAAATGAGCTCTACCCTGCAAAGACCGCGTTGT
TGAACCATATCGCGACATTAAAAAAGAATCATGGCAAGTATTTCCAGTATTCGATGCTGTTGAGTCAGGGGCAGCGTAGT
TTAAGTACATTGAGCCAAATGCTAAATGACTACTTCCCTTTCGCTATTCAAGTTTCCACCAAAACACATGAAAGGCGCCA
ATTGCCTTCTGACTCTCTAACTCGCCTGGGGCAAAAAGAGCATTTTAATAGCCGAGTGGGTCAAGGCTTTTTAATCGGCA
AAACATGTCTGACACATTTTAGTCACCTAATTGTCTCCATCACTCCAAAAACAGAAAACGAGTTGATAGCGATTCAATCA
GACCCATTGTTGGCGAGCAATATGAAAGAGCTCATCCAACATTACTTGAAGGACAACACCCCGACTTCCGTTTATCTAAA
TGTGAAACGGGAGTACTTAAATCGACCACGACTATCAAGCAATAAATATAACGCGGCGAAATTGGGCGAAGTTGATTGCC
TTGCGCCGGAAAGGAAACCTCAACAAATCGTAAGTATTCTTCTGAAGTAA