Detailed information of component protein


Summary

Component ID T6CP015849
Component protein type TssH
T6SS ID (Type) T6SS01275 experimental (Type i4b)
Strain Acinetobacter baumannii DSM 30011
Replicon chromosome
Sequence Protein sequence (894 a.a.); Nucleotide sequence (2682 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) DSM30011_RS11545
Coordinate (Strand) 539980..542661 (-)
NCBI ID 1332932850
RefSeq NZ_JJOC02000004
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 3.1e-41 606..774
AAA_lid_9 PF17871.3 1.3e-24 370..462
AAA PF00004.31 1.2e-11 230..343
ClpB_D2-small PF10431.11 2.3e-11 780..850

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-893 MMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQSLENDLKILLKKYKISADALADDLKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLFPIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAATPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGREYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKGEFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYFEKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSVLDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNQLESLQSEIQETQEQWQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKMVNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANELYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFYQVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLGRMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTVLPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPVKKRTSKKLKSEV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9508 - -



  Protein sequence: 894 a.a.    

>T6CP015849 NZ_JJOC02000004:c542661-539980 [Acinetobacter baumannii] [TssH]
MMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQSLENDLKILLKKYKISADALADDLKETISQLPK
GNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLFPIDSMKHKFLEICEKSVEQQ
EESKTSSQADELEQAATPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGREYEIRLMLDILMRRRQNNPILTGEPGVGKT
AVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKGEFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQN
DAANLLKPALARGELRTIAATTWAEYKQYFEKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTA
VHASHRYISGRQLPDKAVSVLDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNQLESL
QSEIQETQEQWQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKM
VNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANELYGGEQHLIT
INMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFYQVFDKGTLEDGEGRVIDFKN
TTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLGRMRVVPYFPLHDDLLVRIIKHKLGKITARI
EKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTVLPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKP
VKKRTSKKLKSEV*

  Nucleotide sequence: 2682 bp    

>T6CP015849 NZ_JJOC02000004:c542661-539980 [Acinetobacter baumannii] [TssH]
ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTGCTAATGCTTG
TGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCAGTCTTTAGAAAACGATTTAA
AAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTGGCAGATGATTTAAAAGAAACAATTTCTCAATTACCAAAA
GGTAATACACGTACTCCAATTTTTGCTAAATCAATTGTTCGTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACA
AAATCCTGTCATTCGTAGTGGTCATTTATTGGTTGCATTATTAACTGCACCAGACCTCTATCAAATTGCAACAAGAGCTT
CGAGTTTATTTGATCTTTTCCCGATAGACTCAATGAAACATAAGTTTCTTGAAATTTGTGAAAAAAGTGTAGAACAACAA
GAAGAATCAAAAACATCTTCACAAGCAGATGAATTAGAACAAGCCGCGACTCCAACTGCAAAAACTCAAAAAACACCTGC
TTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAACGGCGGGATTGACCCTGTTATTGGGCGTGAATATGAAA
TTCGTTTGATGCTCGATATTTTAATGCGTAGACGTCAGAACAACCCAATTTTAACTGGTGAGCCAGGTGTAGGTAAAACA
GCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGAAGCATTAAAAAATGTTCATTTGCACGTTTT
AGATATGGGGCTTTTGCAAGCTGGTGCAAGTGTTAAAGGTGAATTTGAAAACCGTTTGAAGCAAGTTATTCAAGAAGTCC
AATCATCGGCTCATCCTATTATTTTATTTATTGATGAAGCGCATACGCTTATTGGAGCAGGTGGACAAGCGGGGCAAAAC
GATGCTGCCAATCTTTTAAAACCTGCACTTGCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAA
ACAGTATTTTGAGAAAGATGCTGCATTAAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTG
TAGATATGTTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTTACAAATTGATGATGAAGCAATTGTAACGGCT
GTACATGCCTCTCACCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCAGTAAGTGTTCTTGATACTGCAGCAGCGCG
TGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATCAATTGAAAGCACAAGAACATAACTTAAAGCTTGAGCAAC
AAATTTTGGAAAATGAACACCGTCAAATTCCAATACATCATGAAAGATTAGAAAATCTGAAAAACCAACTAGAGTCATTA
CAAAGTGAGATCCAAGAGACTCAGGAACAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCA
GAGCCATTCTAATGAGTCTGAAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGC
CGTTAGTTTTTGAGCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTTGGGAAAATG
GTCAATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATTATGCACTTAC
ACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAATAAACCTCAAGGGGTGTTCCTTTTAGTTG
GACCTAGTGGGGTTGGTAAAACCGAAACTGCTTTAGCCTTGGCTAATGAGTTATATGGCGGTGAACAGCATTTAATCACG
ATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTTCGCTTAAAGGTGCACCTCCAGGCTATGTTGGCTATGGTCA
GGGTGGGGTTTTAACTGAAGCTGTACGCCGTAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCG
ATGTTCAGGAGTTGTTCTATCAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAAC
ACGACAATCTTATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCC
TACCGCAGAAGATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCCTTTTTAGGGCGTATGAGAG
TTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGGGCAAAATTACTGCTCGAATT
GAAAAACAATATGGAACGGAAGTTCAATATTCAGATGATTTGGTCGAGTTGCTACTCAGCCGTTGTACTGAAGTGGATAG
TGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTTTTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAG
ATCAAAAATTGCCGAAATTGATCATGATTGATGCGAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCT
GTTAAAAAACGGACTAGTAAAAAGTTGAAATCAGAAGTTTAA