Detailed information of component protein


Summary

Component ID T6CP015848
Component protein type TssA
T6SS ID (Type) T6SS01275 experimental (Type i4b)
Strain Acinetobacter baumannii DSM 30011
Replicon chromosome
Sequence Protein sequence (365 a.a.); Nucleotide sequence (1095 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) DSM30011_RS11540
Coordinate (Strand) 538862..539956 (-)
NCBI ID 445942860
RefSeq NZ_JJOC02000004
Uniprot ID A0A0E1FKH3_ACIBA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 5.2e-32 9..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-364 MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEKTKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFTSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPKNEYE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9969 - -



  Protein sequence: 365 a.a.    

>T6CP015848 NZ_JJOC02000004:c539956-538862 [Acinetobacter baumannii] [TssA]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEKTKDIRLLTWV
IEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLY
HENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFTSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHS
TLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVS
YMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPKNEYE*

  Nucleotide sequence: 1095 bp    

>T6CP015848 NZ_JJOC02000004:c539956-538862 [Acinetobacter baumannii] [TssA]
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCATTTTCTAATGA
ATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATTTATTATTAGATCAGGGGGATTGGGTTGCTGAACGGAAACAGG
CAGATTGGGATTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAAACCAAAGATATCCGTCTATTAACTTGGGTA
ATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGGTAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATA
TTGGCAGGATATTCATCCGATTATTGAAGATGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGT
TGCCAATGCTGTTGAAGAAAGTACCTTTAACCAACACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATAT
CACGAAAATATACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTACTTCGGTTTTAACGGAGTGGAATGTTTTAA
AACAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTGCATTTGAAACAATACACAGC
ACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGACTTGCGCCGAGCCAAGAACAGGCCGCTGTCATCACGAC
ACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCAGACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGG
CTAATCGCGAGCAAGCAATGAAAGTGCTGCAAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGC
TATATGCTCCAAAAGACCATTAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCC
ATTGCAAATGGTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA