Detailed information of component protein


Summary

Component ID T6CP015846
Component protein type TssL
T6SS ID (Type) T6SS01275 experimental (Type i4b)
Strain Acinetobacter baumannii DSM 30011
Replicon chromosome
Sequence Protein sequence (269 a.a.); Nucleotide sequence (807 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) DSM30011_RS11530
Coordinate (Strand) 536657..537463 (-)
NCBI ID 446005774
RefSeq NZ_JJOC02000004
Uniprot ID A0A0J0ZX80_ACIBA, V5VEM3_ACIBA, B0VB14_ACIBY, D0C8N1_ACIB2
KEGG ID aby:ABAYE2401
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 1.8e-51 35..237

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELP
Transmembrane helix 217-239 FFWILIFLLIFALLTFAGLRFML
Inside 240-268 NNQNDKALSNYQNVISAPQEQAHITIYLP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9868 - -



  Protein sequence: 269 a.a.    

>T6CP015846 NZ_JJOC02000004:c537463-536657 [Acinetobacter baumannii] [TssL]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQ
FSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCL
LLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELPFFWILIFLLIFALLTFAGLRFMLN
NQNDKALSNYQNVISAPQEQAHITIYLP*

  Nucleotide sequence: 807 bp    

>T6CP015846 NZ_JJOC02000004:c537463-536657 [Acinetobacter baumannii] [TssL]
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATAGCCAGTCCCA
AGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTTTTTAATTCGAAATCAGTATG
TGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAATCGATTTGAGCAACAAGCGAAAAAGTTACAA
TTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTTGTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCC
AAGCTATTTTAATTTACAAAATTCTTGGTTAATTAGCCCATTACAGTTAAGTCTGTTTGGTTCTCAGTTAGCGGGTTATC
AATTCTTCGAAATTTTAGAGCAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTA
TTATTAGGTTTTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATTATCCATCGTG
AGTTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAGGTTTAAGATTTATGCTTAAC
AATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCCACAAGAGCAGGCACATATTACAATTTATTT
ACCTTGA