Detailed information of component protein


Summary

Component ID T6CP015845
Component protein type TssB
T6SS ID (Type) T6SS01274 experimental (Type i2)
Strain Klebsiella pneumoniae subsp. pneumoniae ATCC 43816
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) IT767_RS08600
Coordinate (Strand) 1783754..1784245 (-)
NCBI ID WP_004176434.1
RefSeq NZ_CP064352
Uniprot ID V0AWZ6_KLEPN, W1HNJ0_KLEPN, A0A8B4TVD2_9ENTR, A0A264BV44_KLEVA, A0A652Q1X6_9ENTR, A0A6I4LTW9_9ENTR, A6T833_KLEP7, A0A3S4N0Z0_KLEAE, A0A4V0GXU9_KLEPN, A0A1Y0Q113_KLEPN
KEGG ID kpk:A593_21445, kpn:KPN_01322, kpv:KPNIH29_11375, kvq:SP68_00325, kpt:VK055_1107, kpx:PMK1_03720, kpy:KPNIH31_11025
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 2.1e-52 7..157

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEFSPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9936 - -



  Protein sequence: 164 a.a.    

>T6CP015845 NZ_CP064352:c1784245-1783754 [Klebsiella pneumoniae subsp. pneumoniae ATCC 43816] [TssB]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEFSPEVNLSVPN
TLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSAL
APK*

  Nucleotide sequence: 492 bp    

>T6CP015845 NZ_CP064352:c1784245-1783754 [Klebsiella pneumoniae subsp. pneumoniae ATCC 43816] [TssB]
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCGGCGCGCAAAA
GAAGGTCGAACTGCCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGGAAGGAAAACCGGCCTTTATCGGAAAGAG
AAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTTAGCCCGGAAGTTAACCTCTCGGTGCCGAAT
ACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGCGTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGC
CCGGCAAATTCCGCAACTCCGTGCCATGCTGGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTTGATAACG
CCACTTTCAGAAAAGAGCTTGAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTT
GCCCCGAAATAA