Detailed information of component protein


Summary

Component ID T6CP015834
Component protein type TssJ
T6SS ID (Type) T6SS01274 experimental (Type i2)
Strain Klebsiella pneumoniae subsp. pneumoniae ATCC 43816
Replicon chromosome
Sequence Protein sequence (181 a.a.); Nucleotide sequence (543 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) IT767_RS08515
Coordinate (Strand) 1759057..1759599 (-)
NCBI ID WP_004176417.1
RefSeq NZ_CP064352
Uniprot ID A0A0H3GS07_KLEPH, A0A7U9CZW7_KLEPN, W1HXN0_KLEPN, A0A652Q1B5_9ENTR, A0A0E9Z527_KLEPN, A0A377ZH20_KLEPO, A0A1Y0Q0Z0_KLEPN
KEGG ID kpv:KPNIH29_11490, kpnu:LI86_14515, kpy:KPNIH31_11120, kpg:KPNIH32_11920, kpw:KPNIH30_12080, kpb:FH42_03005, kpne:KU54_014580, kpm:KPHS_23190
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 1.9e-27 47..163

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-180 VLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSEPVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRHPDTQRNTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9981 pos: 22-23. LSG-CG. VLRISLTKTACLLPLLALCLSG



  Protein sequence: 181 a.a.    

>T6CP015834 NZ_CP064352:c1759599-1759057 [Klebsiella pneumoniae subsp. pneumoniae ATCC 43816] [TssJ]
VLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSEPVVVRIYQLK
DRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRHPDTQRNTWKQVLAREELDPD
KPRIFTAEHNQLRLRPEAAK*

  Nucleotide sequence: 543 bp    

>T6CP015834 NZ_CP064352:c1759599-1759057 [Klebsiella pneumoniae subsp. pneumoniae ATCC 43816] [TssJ]
GTGTTACGTATAAGTTTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCGGACTCACCCA
GCGCGTCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATACGCTGCATCTGGACTTTACCG
CGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAACCGGTGGTGGTGCGCATCTATCAGCTTAAA
GATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGCTGGAGGAGGGGGATATTCTGCTCGCCGCCGATCTCCTCGC
CAGTCGCGATGTGGTGATCGGTCCCGGAGGGGACGCCAGTCTGAATATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGG
TTGTCGGCCTGTTCCGCCATCCGGACACACAAAGAAATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGAC
AAGCCGCGCATTTTCACCGCCGAACACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA