Detailed information of component protein


Summary

Component ID T6CP015738
Component protein type TssD
T6SS ID (Type) T6SS01261 experimental (Type i5)
Strain Rhizobium etli bv. mimosae str. Mim1
Replicon plasmid pRetMIM1f
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) REMIM1_RS31810
Coordinate (Strand) 510582..511058 (+)
NCBI ID WP_009990920.1
RefSeq NC_021911
Uniprot ID A0A1C3Y3C8_9HYPH, A0A060IB61_9HYPH, A0A2A6LBY7_9HYPH, S5SWA4_RHIET, A0A7U4L9F2_RHIET, A0A2A5KP19_9HYPH, A0A246SYH2_9HYPH, A0A246ST99_9HYPH, A0A2A6R4C5_9HYPH, A0A2A6JVP7_9HYPH, A0A7W7EFN4_RHIET
KEGG ID rei:IE4771_PD00442, rep:IE4803_PC00430, rel:REMIM1_PF00477
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.2e-33 4..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVSRNMNTSAGSAANREASEPTVSEVILTKVSDSSSTKLFQEACSGRTGKRSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVETIKLNFTKMEVKYTPYDDKHSPQSPMIASYDLATTKAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9880 - -



  Protein sequence: 159 a.a.    

>T6CP015738 NC_021911:510582-511058 [Rhizobium etli bv. mimosae str. Mim1] [TssD]
MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVSRNMNTSAGSAANREASEPTVSEVILTKVSDSSSTKLFQEACSGRTGK
RSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVETIKLNFTKMEVKYTPYDDKHSPQSPMIASYDLATTKAA*

  Nucleotide sequence: 477 bp    

>T6CP015738 NC_021911:510582-511058 [Rhizobium etli bv. mimosae str. Mim1] [TssD]
ATGCCGATTTATCTTCAGATCGACGGTATCCAGGGTGATGCGACCCACGAGCAGCATCGCAAGTGGATGGACATCGAAGC
CATCCACTGGAACGTATCCCGCAACATGAACACCTCCGCTGGTTCTGCGGCCAACCGCGAAGCTTCCGAGCCGACCGTTT
CGGAAGTGATCCTCACCAAGGTCAGCGATTCCTCGTCGACCAAGCTCTTCCAGGAGGCCTGCTCCGGCCGCACCGGCAAG
CGCTCCGTCATCCATCTCGTCACCACGGGCAATCCCGGCGACACCTATATCGAGTACTCGCTCGAGAACACGCTGATCGC
CAGCTACTCGATCGATTCCAACGGCGACCGCCCGGTCGAGACGATCAAGCTGAACTTCACCAAGATGGAAGTGAAGTACA
CGCCTTACGACGACAAGCACTCGCCGCAGTCGCCGATGATCGCGTCTTACGATCTCGCCACCACCAAGGCCGCTTAA