Detailed information of component protein


Summary

Component ID T6CP015726
Component protein type TagF
T6SS ID (Type) T6SS01261 experimental (Type i5)
Strain Rhizobium etli bv. mimosae str. Mim1
Replicon plasmid pRetMIM1f
Sequence Protein sequence (456 a.a.); Nucleotide sequence (1368 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) REMIM1_RS31740
Coordinate (Strand) 489772..491139 (-)
NCBI ID WP_020919498.1
RefSeq NC_021911
Uniprot ID S5S7W3_RHIET
KEGG ID rel:REMIM1_PF00463
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TagF_N PF09867.11 4e-42 18..152
PP2C_2 PF13672.8 1.4e-07 250..363

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-455 MNERATLERTATEADRIGFYGKLPSHGDFVSMGLGHSLQSALDAWMQAGLQAAQQELGEDWKRRFRSMPAWRFIIERGLWGPATVAGVLLPSLDRVGRSFPLVIAAQLHGFAEHPRQLYLDDTWFTAAEAIGESSANRDFDINHFTASLKRLRTLRPADLAENEKLRDRASSRGTIWWRIDPEERRAKGFGVSGAPEPEHFSKLLRDNSPAASPPPETAATPRPIIAKKHHSLLLRHSHATHPGTRLTANADALLISETPSLFAVADGVGEGNNAAEAGRIAVHVLAETAGQQVIEALVQEVKGKLGRAHGLLQSAYLSQDREPSAASIVVLATLDENCALLWVGDARCYLLRDGMMRCLTRDHVVIGLRRRLSRAIGMRGHLTPEVVSGGLQAGDRLLLCSAALPHALPERSIAEILLSADIEKAADILVQEGLIANCRENLSAVVIDVKTDGG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9528 - -



  Protein sequence: 456 a.a.    

>T6CP015726 NC_021911:c491139-489772 [Rhizobium etli bv. mimosae str. Mim1] [TagF]
MNERATLERTATEADRIGFYGKLPSHGDFVSMGLGHSLQSALDAWMQAGLQAAQQELGEDWKRRFRSMPAWRFIIERGLW
GPATVAGVLLPSLDRVGRSFPLVIAAQLHGFAEHPRQLYLDDTWFTAAEAIGESSANRDFDINHFTASLKRLRTLRPADL
AENEKLRDRASSRGTIWWRIDPEERRAKGFGVSGAPEPEHFSKLLRDNSPAASPPPETAATPRPIIAKKHHSLLLRHSHA
THPGTRLTANADALLISETPSLFAVADGVGEGNNAAEAGRIAVHVLAETAGQQVIEALVQEVKGKLGRAHGLLQSAYLSQ
DREPSAASIVVLATLDENCALLWVGDARCYLLRDGMMRCLTRDHVVIGLRRRLSRAIGMRGHLTPEVVSGGLQAGDRLLL
CSAALPHALPERSIAEILLSADIEKAADILVQEGLIANCRENLSAVVIDVKTDGG*

  Nucleotide sequence: 1368 bp    

>T6CP015726 NC_021911:c491139-489772 [Rhizobium etli bv. mimosae str. Mim1] [TagF]
ATGAACGAGCGCGCCACCCTCGAGCGAACTGCGACTGAAGCCGACAGGATCGGCTTCTACGGCAAGCTGCCGAGCCATGG
CGATTTCGTTTCGATGGGGCTCGGCCACAGCTTGCAATCTGCGCTCGACGCCTGGATGCAGGCCGGGCTGCAGGCGGCGC
AGCAGGAACTTGGCGAGGATTGGAAACGTCGCTTCCGCTCGATGCCGGCATGGCGTTTCATAATCGAGCGCGGCCTCTGG
GGGCCGGCAACCGTTGCCGGCGTGTTGCTTCCAAGCCTCGACCGCGTCGGCCGCAGTTTTCCCCTCGTCATCGCCGCCCA
GCTTCACGGTTTTGCCGAGCATCCACGCCAGCTCTATCTCGACGACACGTGGTTCACGGCGGCCGAAGCGATCGGCGAAA
GCTCGGCCAATCGGGATTTCGACATCAATCATTTCACCGCAAGTCTGAAACGGCTGAGGACGCTGCGCCCGGCCGACCTT
GCGGAGAATGAGAAGCTGCGGGACAGAGCTTCCAGCCGCGGCACGATCTGGTGGCGGATCGACCCGGAGGAGCGGCGGGC
CAAGGGGTTTGGCGTCAGCGGCGCCCCGGAACCGGAGCACTTTTCGAAGCTGCTGCGCGACAATTCCCCGGCGGCCTCGC
CGCCGCCCGAAACAGCCGCGACGCCGCGCCCCATCATCGCCAAAAAACACCATTCTCTGCTGCTCCGGCATAGCCATGCC
ACGCATCCCGGCACCCGGCTTACGGCCAATGCCGATGCGCTGCTGATTTCCGAAACGCCCTCGCTCTTTGCCGTCGCCGA
TGGCGTCGGCGAGGGCAACAACGCGGCCGAGGCCGGCAGGATCGCCGTTCATGTGCTGGCCGAAACCGCCGGACAGCAGG
TGATCGAAGCTCTGGTGCAGGAGGTTAAAGGCAAGCTCGGCCGCGCTCACGGCCTGCTTCAGTCGGCCTATCTTTCCCAG
GACCGCGAGCCGTCGGCCGCGAGCATTGTGGTGCTCGCCACGCTTGACGAGAACTGCGCCCTCCTCTGGGTGGGTGACGC
CCGCTGCTACCTGCTGCGGGACGGCATGATGCGCTGCCTCACCCGCGATCATGTCGTGATCGGCCTGCGGCGCAGGCTCT
CGCGCGCCATTGGCATGCGCGGACATCTGACGCCCGAAGTCGTGAGCGGCGGATTGCAGGCCGGCGACCGGCTGCTGCTC
TGCAGCGCGGCCCTTCCGCATGCCCTCCCCGAGCGCAGCATCGCCGAAATCCTGCTTTCGGCAGACATCGAAAAGGCTGC
CGATATTCTCGTGCAGGAAGGGCTGATCGCCAATTGCCGGGAAAACCTCAGCGCCGTCGTGATCGACGTGAAGACCGATG
GCGGATAA