Detailed information of component protein


Summary

Component ID T6CP015684
Component protein type TssK
T6SS ID (Type) T6SS01252 experimental (Type i5)
Strain Vibrio parahaemolyticus strain A3
Replicon chromosome
Sequence Protein sequence (442 a.a.); Nucleotide sequence (1326 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CGH00_RS20290
Coordinate (Strand) 546..1871 (+)
NCBI ID 516016888
RefSeq NZ_NNQJ01000119
Uniprot ID S5JDS6_VIBPH, A0A2S1MEX8_VIBPH
KEGG ID vpf:M634_23125
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.2e-122 19..439

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-441 MMQYSKTAWCEGMFLRPQHFQQHERAISNEYKGLHSLGGSYNWGVWNCRVKEHALKTGLIELDNLQAILPDMTLIDFSATTSFLSPLKVKKGTENTLVKVIVPLSKVSSKMIADPSETTVSRYLLQDLDVIDNLTGQDEETIQVASLNIELKSSNEQLTGYIELPILKIKEVSTEGEVILDDSYVPPLLNLLNDKVMTGYLRNAMAMTKIRADVIAQRLVKGKAASASAVDFIMLQMLNRYEAILKHFSELEKVHPLELATTFKGYIGELATFSHTTKRLPNLKAYDHLEVASVFAELNQVLSQYLSVVLDQTASKLPLEVRQYGIQVTPLPDKRLLESCQFVLAIKADTTTDEIRRLVPAQLKLGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGGIALHLSGHFPNPDIELWSINQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9884 - -



  Protein sequence: 442 a.a.    

>T6CP015684 NZ_NNQJ01000119:546-1871 [Vibrio parahaemolyticus] [TssK]
MMQYSKTAWCEGMFLRPQHFQQHERAISNEYKGLHSLGGSYNWGVWNCRVKEHALKTGLIELDNLQAILPDMTLIDFSAT
TSFLSPLKVKKGTENTLVKVIVPLSKVSSKMIADPSETTVSRYLLQDLDVIDNLTGQDEETIQVASLNIELKSSNEQLTG
YIELPILKIKEVSTEGEVILDDSYVPPLLNLLNDKVMTGYLRNAMAMTKIRADVIAQRLVKGKAASASAVDFIMLQMLNR
YEAILKHFSELEKVHPLELATTFKGYIGELATFSHTTKRLPNLKAYDHLEVASVFAELNQVLSQYLSVVLDQTASKLPLE
VRQYGIQVTPLPDKRLLESCQFVLAIKADTTTDEIRRLVPAQLKLGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGY
VYFEVVKKGPFWMRLKDSGGIALHLSGHFPNPDIELWSINQ*

  Nucleotide sequence: 1326 bp    

>T6CP015684 NZ_NNQJ01000119:546-1871 [Vibrio parahaemolyticus] [TssK]
ATGATGCAATACTCCAAGACGGCTTGGTGCGAGGGGATGTTTCTGCGTCCCCAGCATTTTCAACAGCACGAACGCGCAAT
ATCTAATGAATATAAAGGCTTACACAGTTTAGGTGGCTCATATAACTGGGGCGTTTGGAATTGCCGTGTAAAAGAACATG
CCTTAAAAACAGGCTTGATTGAACTTGATAATCTTCAAGCAATTCTTCCTGATATGACGCTGATAGACTTTTCAGCAACG
ACAAGTTTTCTGTCTCCTTTAAAGGTAAAAAAAGGGACGGAAAATACCTTAGTGAAGGTGATCGTTCCACTCTCAAAAGT
CAGCAGTAAAATGATCGCGGATCCAAGTGAAACAACGGTTTCTCGGTATTTACTTCAAGATCTAGACGTTATTGATAACC
TGACGGGCCAAGATGAAGAAACGATTCAAGTGGCCTCATTAAATATCGAGCTGAAATCAAGCAATGAGCAGTTAACAGGT
TATATAGAGCTACCAATCCTTAAGATTAAAGAAGTTTCTACGGAAGGAGAGGTCATTCTTGATGACTCTTACGTACCACC
ACTTCTAAACTTGTTAAATGACAAGGTGATGACAGGGTATCTACGTAATGCAATGGCAATGACCAAGATACGCGCAGATG
TTATCGCTCAACGACTTGTTAAAGGAAAAGCGGCTTCAGCATCTGCGGTAGATTTCATAATGCTGCAAATGTTGAATCGA
TATGAAGCCATATTGAAGCATTTTAGTGAGCTGGAGAAAGTACACCCCTTAGAGCTTGCGACAACCTTTAAAGGCTACAT
AGGCGAGTTGGCAACGTTTTCTCACACCACCAAGCGCTTACCTAATCTCAAAGCTTACGATCACCTTGAAGTTGCAAGTG
TGTTTGCTGAACTTAATCAAGTCCTTAGTCAGTACTTGAGTGTCGTTCTTGATCAGACTGCAAGTAAGTTGCCACTAGAA
GTACGCCAGTACGGTATCCAAGTGACACCACTTCCAGATAAGCGACTATTGGAATCATGTCAGTTTGTATTGGCGATTAA
AGCGGACACAACAACGGATGAGATTAGACGCTTAGTCCCTGCGCAATTGAAGCTTGGTCCGGCAGAACAGATTAGAGATC
TAATCAACAACCAGATTAATGGAATTAACGTAGCTCCTTTAAGTGTCGTGCCGCGACAGATTCCATATCAAACCGGGTAT
GTTTATTTTGAGGTCGTTAAGAAGGGGCCATTCTGGATGCGACTTAAAGACAGCGGTGGTATTGCACTGCATTTATCTGG
TCATTTCCCAAATCCGGACATAGAGCTTTGGAGCATTAATCAATAA