Detailed information of component protein


Summary

Component ID T6CP015595
Component protein type TssD
T6SS ID (Type) T6SS01243 experimental (Type i5)
Strain Agrobacterium fabrum strain 12D13
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) At12D13_RS20965
Coordinate (Strand) 1440824..1441300 (+)
NCBI ID WP_003504561.1
RefSeq NZ_CP033035
Uniprot ID A0A2W5FF79_9HYPH, A0A420FGI5_9HYPH, A0A1S9EUT1_9HYPH, A0A1S7QKJ0_RHIRD, A0A822V711_RHIRD, A0A1S7S980_RHIRD, A0A1S7U5K7_9HYPH, A0A1S7QJJ5_9HYPH, A0A1S7REK6_9HYPH, A0A0X6ZNV9_9HYPH, A0A1G5HNE2_9HYPH, A0A7Z1S8Q1_9HYPH, A9CGG8_AGRFC, A0A4Z0SAD8_9HYPH, A0A4Z0SX09_9HYPH, A0A7Z8K4Y9_9HYPH, A0A3S2U2I1_9HYPH, A0A7I0RM16_9HYPH, A0A5D9CT02_9HYPH, A0A846LE15_9HYPH, A0A083ZID2_RHIRD, A0A0X7A9B9_9HYPH
KEGG ID atu:Atu4345
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 8.8e-33 4..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9890 - -



  Protein sequence: 159 a.a.    

>T6CP015595 NZ_CP033035:1440824-1441300 [Agrobacterium fabrum] [TssD]
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLFQEACAGRTGK
LATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA*

  Nucleotide sequence: 477 bp    

>T6CP015595 NZ_CP033035:1440824-1441300 [Agrobacterium fabrum] [TssD]
ATGCCAATTTATCTGCAGATTGACGGTATCCAGGGCGACGCCACCCATGAAGAACATCGCAAGTGGATGGATATTGAAGC
CATTCACTGGAATGTGGCCCGCAACATGAACACGTCGGCTGGTTCTGCTGCAAACCGCGAAGCGTCCGAACCGACCATTT
CGGAAGTCATTCTGACAAAGGTTAGCGACTCGTCTTCCACGAAGCTTTTCCAGGAGGCCTGTGCTGGCCGCACTGGCAAG
CTTGCAACGATCCATCTGGTGACGACCGGCAATCCGGGCAACACCTATATCGAATACCTGCTGACGAACACCCTTATCGC
CAGCTACTCGGTGGATTCCAGCGGGGATCGTCCGGTGGAGACCATCAAGCTCAACTTCACGAAAATGGAAGTGAAGTACA
CGCCGTTCGACGACAACAACTCGCCGCAGTCTCCGATGATCGCTTCCTACGATCTGGCGACGACCAAGGCTGCTTGA