Detailed information of component protein


Summary

Component ID T6CP015593
Component protein type TssA
T6SS ID (Type) T6SS01243 experimental (Type i5)
Strain Agrobacterium fabrum strain 12D13
Replicon chromosome
Sequence Protein sequence (352 a.a.); Nucleotide sequence (1056 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) At12D13_RS20955
Coordinate (Strand) 1436812..1437867 (-)
NCBI ID WP_010973762.1
RefSeq NZ_CP033035
Uniprot ID A0A7Z7BQW2_9HYPH, A9CGG7_AGRFC, A0A7I0RMM6_9HYPH, A0A0F4FLA7_RHIRD
KEGG ID atu:Atu4343
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 1.8e-22 15..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-351 MDTQHVKRDIEFLGNCGDNIRNDSRTREIYYRIKDERNQARAEERAASPQDNLKISSSWDSVSNLGLQIIYSESKDVEILAWLAEASLRLRGFHGLREIYELCGDLFYNHWDSLRSISDDNDEEKFAPFAGLNGIGSEGTLVQPLRLASLIPGGKFGEHSLWDFQLAQRPNESKRREELYRIASEAGVAAMSSHLAAVNTCLSSFDAITAVLSERCGQAAPPSSNIRNTLIEAAAAIRTLGGRDQEPAPVEQTPAIAAGTDESGQSAARTSPASPEGISSRDEAFETLLSVARYFRRTEPHSPISLSIETLVRRGRMDFSELLAELLPETQARNAVLTAAGIKPGGDNNGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9809 - -



  Protein sequence: 352 a.a.    

>T6CP015593 NZ_CP033035:c1437867-1436812 [Agrobacterium fabrum] [TssA]
MDTQHVKRDIEFLGNCGDNIRNDSRTREIYYRIKDERNQARAEERAASPQDNLKISSSWDSVSNLGLQIIYSESKDVEIL
AWLAEASLRLRGFHGLREIYELCGDLFYNHWDSLRSISDDNDEEKFAPFAGLNGIGSEGTLVQPLRLASLIPGGKFGEHS
LWDFQLAQRPNESKRREELYRIASEAGVAAMSSHLAAVNTCLSSFDAITAVLSERCGQAAPPSSNIRNTLIEAAAAIRTL
GGRDQEPAPVEQTPAIAAGTDESGQSAARTSPASPEGISSRDEAFETLLSVARYFRRTEPHSPISLSIETLVRRGRMDFS
ELLAELLPETQARNAVLTAAGIKPGGDNNGK*

  Nucleotide sequence: 1056 bp    

>T6CP015593 NZ_CP033035:c1437867-1436812 [Agrobacterium fabrum] [TssA]
TTGGATACACAGCATGTTAAAAGAGATATAGAGTTTTTGGGGAATTGCGGAGATAATATCCGCAACGATTCAAGAACGCG
TGAAATATACTATAGAATTAAGGACGAAAGAAACCAGGCACGCGCAGAAGAACGGGCCGCCTCCCCTCAGGATAACCTGA
AGATCTCCAGTAGCTGGGACAGTGTCAGCAATCTTGGATTGCAGATTATATATTCCGAAAGCAAGGATGTTGAAATATTG
GCATGGCTTGCGGAAGCAAGCCTGCGACTTCGCGGCTTCCATGGACTGCGCGAAATCTACGAGCTTTGTGGTGATCTTTT
TTACAACCACTGGGACTCATTGCGCTCGATCAGCGACGATAATGACGAAGAAAAATTTGCACCTTTTGCGGGATTGAATG
GCATTGGCAGCGAGGGAACACTTGTTCAGCCACTCAGGCTGGCATCGCTGATCCCCGGAGGCAAATTCGGAGAACACAGT
CTCTGGGATTTCCAGCTGGCGCAGCGGCCGAACGAGAGCAAACGCCGCGAAGAACTGTACCGGATAGCCTCCGAGGCCGG
TGTTGCCGCCATGTCTTCCCATCTGGCAGCGGTGAATACCTGTCTCTCCTCGTTTGACGCCATTACCGCCGTTCTTTCCG
AACGTTGCGGCCAGGCCGCCCCCCCGAGCTCCAATATCCGCAACACGCTTATCGAAGCGGCCGCGGCAATTCGCACGCTG
GGTGGGCGCGACCAGGAACCGGCACCGGTCGAACAGACGCCGGCCATTGCTGCGGGCACCGATGAAAGCGGGCAGTCGGC
CGCGCGGACATCCCCGGCATCCCCGGAAGGCATATCTTCGCGCGATGAGGCGTTTGAAACTCTTCTTTCGGTTGCGCGTT
ACTTTCGCCGAACCGAACCGCATTCACCGATCTCGCTCTCCATCGAAACGCTGGTTCGCAGGGGGCGCATGGATTTCTCG
GAACTGCTGGCCGAGCTTCTGCCGGAAACGCAGGCCCGAAACGCCGTTCTGACGGCCGCCGGCATCAAACCCGGCGGAGA
CAATAACGGGAAATAA