Detailed information of component protein


Summary

Component ID T6CP015591
Component protein type TssC
T6SS ID (Type) T6SS01243 experimental (Type i5)
Strain Agrobacterium fabrum strain 12D13
Replicon chromosome
Sequence Protein sequence (494 a.a.); Nucleotide sequence (1482 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) At12D13_RS20945
Coordinate (Strand) 1434662..1436143 (-)
NCBI ID WP_121691718.1
RefSeq NZ_CP033035
Uniprot ID UPI000EF567A0
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 2.7e-134 65..369
VipB_2 PF18945.2 2.7e-46 378..489

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-493 MSAESLLKSEAQATTAEDQGLLSKVVSATRQTEPDRAQNLLRTLTDQALKGTVKYDRNLTVTLNHAIAELDRTISEQLAAIMQAPEFAKLEGTWRGLNYLVKNSETSVNLKIRVMNAGKRELARDLEKAVEFDQSRLFKAIYEDEFGTPGGEPLGAIIGDYEFDNSFDDVQLLQGVSSIAAAAFAPFISAASPHMFGFEDYRDLARPRDLEKIFDTVEYAKWRSFRESDDSRFVTLALPRVLARMPYGPKTNPVDDFAYDETRGAVNGDLQHDEYCWMNAAYVMGTKLTEAFAKSGWCTAIRGAENGGRVENLPMHVFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLPLCHYKNTDYAVFFGAQTAHKPKLYDKPEATANAAVSARLPYIMATSRFAHYLKVMGRDKIGSFMEASDCEVWLNRWIANYVNANDEAGEESRAKYPLRDAKVTVQEVPGKPGAYNAVAWMRPWLQMEELTTSLRMVARIPSKN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9882 - -



  Protein sequence: 494 a.a.    

>T6CP015591 NZ_CP033035:c1436143-1434662 [Agrobacterium fabrum] [TssC]
MSAESLLKSEAQATTAEDQGLLSKVVSATRQTEPDRAQNLLRTLTDQALKGTVKYDRNLTVTLNHAIAELDRTISEQLAA
IMQAPEFAKLEGTWRGLNYLVKNSETSVNLKIRVMNAGKRELARDLEKAVEFDQSRLFKAIYEDEFGTPGGEPLGAIIGD
YEFDNSFDDVQLLQGVSSIAAAAFAPFISAASPHMFGFEDYRDLARPRDLEKIFDTVEYAKWRSFRESDDSRFVTLALPR
VLARMPYGPKTNPVDDFAYDETRGAVNGDLQHDEYCWMNAAYVMGTKLTEAFAKSGWCTAIRGAENGGRVENLPMHVFSS
DDGDLDLKCPTEVGITDRRDAELGKLGFLPLCHYKNTDYAVFFGAQTAHKPKLYDKPEATANAAVSARLPYIMATSRFAH
YLKVMGRDKIGSFMEASDCEVWLNRWIANYVNANDEAGEESRAKYPLRDAKVTVQEVPGKPGAYNAVAWMRPWLQMEELT
TSLRMVARIPSKN*

  Nucleotide sequence: 1482 bp    

>T6CP015591 NZ_CP033035:c1436143-1434662 [Agrobacterium fabrum] [TssC]
ATGAGCGCTGAAAGCCTGCTGAAAAGCGAAGCACAGGCAACGACCGCCGAAGATCAGGGACTGCTGTCCAAGGTGGTTTC
CGCAACCCGCCAGACCGAACCGGATCGCGCGCAGAACCTCTTGCGCACGCTGACCGATCAGGCCCTGAAGGGAACGGTCA
AATATGACCGCAACCTCACGGTCACCCTCAATCACGCGATCGCCGAGCTGGACCGGACGATTTCCGAGCAGCTCGCTGCC
ATCATGCAGGCGCCGGAATTCGCCAAGCTGGAAGGCACCTGGCGCGGGCTCAACTATCTCGTCAAGAATTCCGAGACGAG
CGTGAACCTCAAGATCCGTGTCATGAACGCCGGCAAGCGTGAACTGGCGCGCGATCTGGAAAAAGCCGTCGAATTCGATC
AGTCCCGCCTCTTCAAGGCGATCTACGAAGACGAATTCGGCACGCCTGGCGGCGAACCGCTCGGCGCCATCATCGGTGAC
TATGAATTCGACAATTCCTTCGATGACGTGCAGCTGCTGCAGGGCGTCTCATCGATCGCGGCGGCGGCTTTCGCGCCGTT
CATCTCGGCCGCCAGCCCGCACATGTTCGGTTTCGAGGACTATCGCGACCTCGCCCGTCCGCGCGATCTGGAAAAAATTT
TCGACACGGTGGAATATGCCAAGTGGCGCAGCTTCCGCGAAAGCGACGATTCCCGTTTCGTCACGCTCGCCTTGCCGCGT
GTGCTGGCCCGCATGCCCTATGGTCCAAAGACCAACCCCGTCGATGATTTCGCCTATGACGAAACCAGGGGCGCGGTAAA
TGGCGATCTGCAGCATGACGAATATTGCTGGATGAACGCCGCCTACGTCATGGGCACCAAGCTAACCGAGGCTTTTGCAA
AGAGCGGCTGGTGCACGGCGATCCGCGGTGCGGAAAATGGCGGCCGGGTGGAAAACCTGCCCATGCACGTCTTCTCCAGC
GATGACGGCGATCTGGACCTGAAATGCCCGACCGAAGTGGGCATCACCGACCGCCGCGATGCGGAACTCGGCAAGCTCGG
CTTCCTGCCGCTCTGCCACTATAAGAACACGGATTATGCGGTGTTCTTCGGTGCCCAGACTGCACACAAACCGAAGCTTT
ACGACAAGCCGGAAGCCACGGCCAATGCCGCCGTTTCCGCCCGCCTGCCCTATATAATGGCGACCTCGCGTTTCGCGCAT
TATCTCAAGGTGATGGGCCGCGACAAGATCGGCTCGTTCATGGAAGCGTCCGACTGCGAAGTCTGGCTCAATCGCTGGAT
CGCCAACTACGTCAACGCCAATGACGAAGCGGGCGAAGAAAGCCGGGCGAAATATCCGCTGCGCGATGCCAAGGTGACCG
TGCAGGAAGTGCCCGGCAAACCCGGCGCCTACAACGCGGTCGCATGGATGCGGCCCTGGTTGCAGATGGAAGAACTGACG
ACCTCGCTGCGCATGGTCGCCCGTATTCCGTCTAAGAACTGA