Detailed information of component protein


Summary

Component ID T6CP015584
Component protein type TssM
T6SS ID (Type) T6SS01243 experimental (Type i5)
Strain Agrobacterium fabrum strain 12D13
Replicon chromosome
Sequence Protein sequence (1160 a.a.); Nucleotide sequence (3480 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) At12D13_RS20900
Coordinate (Strand) 1421584..1425063 (-)
NCBI ID WP_121691710.1
RefSeq NZ_CP033035
Uniprot ID UPI000EF5C5DB
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 2.3e-78 203..442
IcmF-related PF06761.14 9.1e-61 496..793
IcmF_C PF06744.14 6.6e-18 1037..1140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-24 MNPLSYFYTIRSYVESYAALVGRR
Transmembrane helix 25-47 FLSLLWVIALCVVIWFYGYLIAL
Outside 48-56 GDFKPLGTV
Transmembrane helix 57-79 QARLIAIGIIVAVWLVYIIVTIY
Inside 80-432 RGRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGAPGSGKTTALTNSGLQFPLGDALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGFLGLLRRYRRSQPINGALVTLSIPDLLNRDPEEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGFVEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFELLQQRVDAMLIERLQQEQNAEIRGRIFRFPAELARLKDRLHEALAELCASSPLIEAPLLRGVYFASGTQPETEKSPAASRTRRSYFLSRLFKDVIFPEAALVTRDKRLSRRQ
Transmembrane helix 433-455 LLVRRIAYAVSATAVAIVFTGWI
Outside 456-1159 FTYFANTQALAEADRKLGAYEQLVQGIPVREVADADFLRILPALDNLRDVNSGFARERVWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKDEKDVTRTFNSLKLYGMLGGMGGLDRDFLTTQTHQMFASLYPGDGRAAAREALDQHAKALADGVLAPIELDARLIATARETIRDQAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMAEGIEGLFTADGYRRVVIPQVAHAARVALSEGWVRGSDDAIKGATVEQVAQAALQIYFDRFEKIWADTLSDLRVKPSQSLGDAVETTRALANERNIVVEAARSIAEATDLRPGANPAALASAAEGDATAAVLAATVNAADPYARLRDMLATKGAATTGEQPNGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEVAKVFDVDSQLTKANQDLLQQARELPAPLDVWVAGVAADVGSLAVKSARSRIAELWTADSASLCSSIVTGRYPFDRASSRDVAIADFTRLFAPTGVFQSFFKQRMEPFVDKTTTPWSWKGTFGAAGIPSSAVAQFENANKISRAFFPNGSETPTVSINVKPVSLTNASSAVMLEIEGERVVYYHGPIQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGANIENQSGELLRVRFENGVQAAEFDIQFGSVLNPFKLDAIASFACPAQF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9908 - -



  Protein sequence: 1160 a.a.    

>T6CP015584 NZ_CP033035:c1425063-1421584 [Agrobacterium fabrum] [TssM]
MNPLSYFYTIRSYVESYAALVGRRFLSLLWVIALCVVIWFYGYLIALGDFKPLGTVQARLIAIGIIVAVWLVYIIVTIYR
GRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGAPGSGKTTALTNSGLQFPLGD
ALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGFLGLLRRYRRSQPINGALVTLSIPDLLNRDP
EEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGFVEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFE
LLQQRVDAMLIERLQQEQNAEIRGRIFRFPAELARLKDRLHEALAELCASSPLIEAPLLRGVYFASGTQPETEKSPAASR
TRRSYFLSRLFKDVIFPEAALVTRDKRLSRRQLLVRRIAYAVSATAVAIVFTGWIFTYFANTQALAEADRKLGAYEQLVQ
GIPVREVADADFLRILPALDNLRDVNSGFARERVWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKDEKD
VTRTFNSLKLYGMLGGMGGLDRDFLTTQTHQMFASLYPGDGRAAAREALDQHAKALADGVLAPIELDARLIATARETIRD
QAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMAEGIEGLFTADGYRRVVIPQVAHAARVALSEGWVR
GSDDAIKGATVEQVAQAALQIYFDRFEKIWADTLSDLRVKPSQSLGDAVETTRALANERNIVVEAARSIAEATDLRPGAN
PAALASAAEGDATAAVLAATVNAADPYARLRDMLATKGAATTGEQPNGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEV
AKVFDVDSQLTKANQDLLQQARELPAPLDVWVAGVAADVGSLAVKSARSRIAELWTADSASLCSSIVTGRYPFDRASSRD
VAIADFTRLFAPTGVFQSFFKQRMEPFVDKTTTPWSWKGTFGAAGIPSSAVAQFENANKISRAFFPNGSETPTVSINVKP
VSLTNASSAVMLEIEGERVVYYHGPIQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGANIENQSGEL
LRVRFENGVQAAEFDIQFGSVLNPFKLDAIASFACPAQF*

  Nucleotide sequence: 3480 bp    

>T6CP015584 NZ_CP033035:c1425063-1421584 [Agrobacterium fabrum] [TssM]
ATGAATCCATTGAGCTATTTTTATACGATCCGTTCCTATGTCGAGAGCTATGCGGCCCTCGTCGGCCGGCGTTTCCTCTC
GCTTTTATGGGTGATCGCGCTCTGCGTCGTCATCTGGTTCTACGGCTATCTGATCGCGCTCGGCGATTTCAAACCGCTTG
GAACGGTGCAGGCGCGGCTCATCGCCATCGGCATCATCGTCGCCGTCTGGCTGGTCTACATCATCGTCACGATCTACCGC
GGCCGCAAACAGGACAAGGAACTCGTCGATAGTATCGAGCGCGAGGCGCTGGCCAATCGGCAGGCGGAAATCGGCGAAAT
CCAGACTCGCCTGAAAGAAGCGCTCGCGCTCTTGCGGCGCGTCACGAAAAAGCGCTTCGGTTACATTTACGACTTGCCCT
GGTACGTGATCTTCGGCGCACCCGGCTCCGGGAAGACGACGGCGCTGACCAATTCCGGCCTGCAATTTCCGCTTGGCGAT
GCGCTCGGTGAAAATGCGGTGAAGGGTATCGGTGGTACGCGCAACTGTAACTGGTGGTTCGCGGATGAGGCGATCCTTAT
CGACACTGCCGGTCGCTATACCACCCAGGATGACCTCGACGGTTCCTCGAAGGCCGGCTGGGAAGGCTTTCTTGGCCTTT
TGAGGCGATATCGCCGTTCGCAGCCGATCAATGGCGCATTGGTCACCCTGTCCATTCCCGATCTGCTCAACCGCGATCCC
GAAGAACAACGGCAGGAGCTGCGCTCCATCCGCCAGCGTCTTTCGGAACTTGACGAATATCTGCATGCCCGCGTTCCGGT
CTATATCGTCCTGACGAAAGCCGACCTGCTGCATGGTTTCGTGGAATTTTTCGATGGATTCAACAAGACCGACCGCCAGC
AGGTGTGGGGCACCACCTTCAAGCTGGATGAGAGCTACTCCGCCGAAAACCTGCCGCAGCGCCTGACGGAAGAATTCGAA
CTGCTACAGCAGCGGGTCGATGCCATGCTGATCGAACGCCTGCAGCAGGAGCAGAATGCGGAGATACGCGGCCGTATCTT
CCGTTTTCCAGCCGAACTCGCGCGGCTGAAAGATCGCCTGCACGAGGCCCTTGCCGAACTTTGCGCAAGTTCGCCTCTCA
TCGAGGCGCCGCTTCTGCGCGGCGTTTATTTCGCGTCGGGAACGCAGCCGGAAACGGAAAAATCTCCCGCGGCATCCAGA
ACCCGCCGCAGCTATTTCCTGTCGCGGTTGTTCAAGGACGTCATCTTCCCTGAAGCCGCTCTGGTGACGCGTGACAAGCG
CCTTTCCCGGCGGCAATTGCTGGTGCGGCGCATTGCTTATGCCGTATCCGCCACGGCGGTCGCCATCGTCTTCACCGGCT
GGATTTTCACCTATTTCGCCAATACGCAGGCGCTGGCCGAAGCGGATCGCAAACTTGGCGCTTATGAGCAGCTCGTTCAG
GGAATTCCCGTGCGCGAGGTCGCGGACGCCGATTTCCTGCGGATCCTCCCCGCGCTCGACAATCTGCGCGATGTCAATTC
CGGCTTTGCCCGCGAACGCGTGTGGAATGTCAGCTTCGGTCTTGATCAGGAAGACAAGATTGCCGGCCGGCAGCGTGACG
CCTATCAGCGCGCACTCAACGCCCTTCTGCTGCCGCGCATGATCGTGCAGCTGCAAAAGCAGCTGAAGGACGAAAAGGAT
GTCACCCGCACGTTCAATTCGCTGAAACTCTACGGAATGCTGGGCGGGATGGGTGGTCTGGACCGCGATTTCCTGACCAC
GCAGACGCATCAGATGTTCGCATCCCTTTATCCCGGTGACGGAAGGGCGGCGGCGAGAGAAGCGCTTGACCAGCATGCAA
AGGCGCTCGCTGACGGCGTGCTCGCCCCGATCGAGCTCGATGCGCGGCTCATCGCCACCGCCCGCGAAACCATCCGCGAT
CAGGCGATTGGCACACGCGCCTATGATATTCTCGCCGGCCTTCCGCAAGTGCGGGAATTGATGGAATGGACACCCGCTAC
GGCTTTCGGCCCGCTGGGGGAGCGTGCTTTCGAGCGTCGCAGCAAAGCGCCGATGGCCGAGGGGATAGAGGGCCTTTTCA
CCGCCGATGGATATCGCCGCGTTGTCATCCCGCAGGTCGCGCATGCGGCCCGCGTCGCGCTTTCCGAAGGATGGGTGCGC
GGTTCTGACGATGCCATCAAGGGTGCGACTGTCGAGCAGGTGGCGCAGGCCGCGCTGCAAATCTATTTCGACAGGTTCGA
GAAAATATGGGCCGACACGCTGTCCGATCTGCGCGTCAAACCATCCCAGAGCCTCGGCGACGCGGTGGAGACAACACGGG
CTCTTGCCAATGAGCGCAATATCGTGGTGGAGGCTGCCAGATCGATCGCAGAGGCGACCGATCTCCGCCCCGGAGCAAAC
CCCGCCGCCCTCGCCTCCGCTGCGGAAGGAGACGCAACCGCAGCCGTTCTGGCCGCTACGGTGAATGCGGCCGATCCCTA
TGCGAGACTGCGCGACATGCTGGCGACGAAAGGCGCAGCTACAACGGGCGAGCAGCCCAATGGCGACAAGACCGGTGGTT
CGCCATCGGAACAGTTACTCGCGCATTTCAAGCTGCTGAACGAACAGCTTGCCCGTTCGGCAACCACCTCCGATGAGGTC
GCCAAGGTGTTCGACGTGGACAGCCAGCTCACCAAGGCCAATCAGGATCTGTTGCAGCAGGCACGCGAATTGCCGGCACC
GCTCGACGTCTGGGTGGCAGGCGTGGCGGCGGATGTCGGCTCGCTCGCGGTCAAGTCCGCACGCAGCCGCATCGCCGAAC
TCTGGACGGCCGATTCAGCCTCCCTGTGCTCCTCGATCGTGACCGGTCGTTATCCCTTCGACCGAGCCTCCTCCCGCGAT
GTCGCGATTGCGGATTTTACCCGTCTCTTCGCGCCGACGGGGGTTTTCCAGAGCTTCTTCAAACAGCGCATGGAACCGTT
TGTCGACAAGACGACGACCCCATGGAGCTGGAAAGGCACCTTCGGCGCCGCCGGCATTCCCAGCAGCGCCGTCGCCCAGT
TCGAAAATGCCAACAAGATTTCGCGCGCCTTTTTCCCGAATGGCAGCGAGACGCCGACGGTTTCGATCAATGTCAAACCC
GTCTCGCTCACCAATGCCTCCAGCGCGGTGATGCTGGAAATCGAAGGCGAGCGGGTCGTTTATTATCATGGACCGATCCA
GGCGAAATCGATTACCTGGCCCTCGCGCGAAAACACGGCGAGCCTGTCGCGCATCGCCTTCCAGCCGGGCGGCTGGCAGC
AGGCGAAGACCGAAAACGGCGACTGGTCGCCCTTCCGGCTGTTTGACGGTGCCAATATCGAAAATCAGTCGGGTGAGCTG
TTGCGGGTGCGGTTTGAGAATGGCGTCCAGGCTGCCGAGTTCGATATTCAGTTCGGCTCGGTTCTCAATCCATTCAAGCT
GGATGCGATTGCCAGCTTCGCCTGCCCTGCGCAGTTCTAG